DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3566 and CB5-D

DIOPT Version :9

Sequence 1:NP_572304.5 Gene:CG3566 / 31562 FlyBaseID:FBgn0029854 Length:117 Species:Drosophila melanogaster
Sequence 2:NP_199692.1 Gene:CB5-D / 834939 AraportID:AT5G48810 Length:140 Species:Arabidopsis thaliana


Alignment Length:122 Identity:52/122 - (42%)
Similarity:69/122 - (56%) Gaps:23/122 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 KEIRLATVNEHNKATDLWVVIDNKVYDVTKFRLEHPGGEESLVDEAGRDATKAFNDVGHSSEARE 67
            |...|:.|::|:.|.|.|:|||.||||||||..:||||:|.::...|:|||..|.||||||.|:.
plant     6 KVFTLSEVSQHSSAKDCWIVIDGKVYDVTKFLDDHPGGDEVILTSTGKDATDDFEDVGHSSTAKA 70

  Fly    68 MLKKYYIGDLAAADIKKKS----PISCRHVA-------------------LALGAAF 101
            ||.:||:||:..|.:..|:    |.|.:.||                   |.||.||
plant    71 MLDEYYVGDIDTATVPVKAKFVPPTSTKAVATQDKSSDFVIKLLQFLVPLLILGLAF 127

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3566NP_572304.5 Cyt-b5 4..77 CDD:278597 39/72 (54%)
CB5-DNP_199692.1 Cyt-b5 9..81 CDD:395121 40/71 (56%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 94 1.000 Domainoid score I2520
eggNOG 1 0.900 - - E1_COG5274
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1566561at2759
OrthoFinder 1 1.000 - - FOG0000784
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100589
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X609
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
87.680

Return to query results.
Submit another query.