DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3566 and CB5-C

DIOPT Version :9

Sequence 1:NP_572304.5 Gene:CG3566 / 31562 FlyBaseID:FBgn0029854 Length:117 Species:Drosophila melanogaster
Sequence 2:NP_182188.1 Gene:CB5-C / 819277 AraportID:AT2G46650 Length:132 Species:Arabidopsis thaliana


Alignment Length:93 Identity:35/93 - (37%)
Similarity:57/93 - (61%) Gaps:4/93 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSKEIRLATVNEHNKATDLWVVIDNKVYDVTKFRLEHPGGEESLVDEAGRDATKAFNDVGHSSEA 65
            |:..|....|.:|....|.|::|..||||::.|..|||||:..|:...|:||:..|.||.||.:|
plant     1 MANLISFHDVAKHKCKNDCWILIHGKVYDISTFMDEHPGGDNVLLAVTGKDASIDFEDVNHSKDA 65

  Fly    66 REMLKKYYIGDLAAADIKKKSPISCRHV 93
            :|::|||.|||:..:.:    |::.:::
plant    66 KELMKKYCIGDVDQSTV----PVTQQYI 89

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3566NP_572304.5 Cyt-b5 4..77 CDD:278597 32/72 (44%)
CB5-CNP_182188.1 Cyt-b5 6..78 CDD:395121 32/71 (45%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5274
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1566561at2759
OrthoFinder 1 1.000 - - FOG0000784
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X609
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
65.780

Return to query results.
Submit another query.