DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3566 and CB5-B

DIOPT Version :10

Sequence 1:NP_572304.5 Gene:CG3566 / 31562 FlyBaseID:FBgn0029854 Length:117 Species:Drosophila melanogaster
Sequence 2:NP_180831.1 Gene:CB5-B / 817832 AraportID:AT2G32720 Length:134 Species:Arabidopsis thaliana


Alignment Length:84 Identity:43/84 - (51%)
Similarity:61/84 - (72%) Gaps:0/84 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 SKEIRLATVNEHNKATDLWVVIDNKVYDVTKFRLEHPGGEESLVDEAGRDATKAFNDVGHSSEAR 66
            :|...|:.|:|||:|.|.|:||:.|||:||||..:||||::.|:...|:|||..|.|||||..||
plant     5 AKIFTLSEVSEHNQAHDCWIVINGKVYNVTKFLEDHPGGDDVLLSSTGKDATDDFEDVGHSESAR 69

  Fly    67 EMLKKYYIGDLAAADIKKK 85
            ||:::||:|::....|.||
plant    70 EMMEQYYVGEIDPTTIPKK 88

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3566NP_572304.5 Cyt-b5 6..78 CDD:459698 39/71 (55%)
CB5-BNP_180831.1 Cyt-b5 9..81 CDD:459698 39/71 (55%)

Return to query results.
Submit another query.