DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3566 and Cyb5a

DIOPT Version :9

Sequence 1:NP_572304.5 Gene:CG3566 / 31562 FlyBaseID:FBgn0029854 Length:117 Species:Drosophila melanogaster
Sequence 2:NP_071581.1 Gene:Cyb5a / 64001 RGDID:620558 Length:134 Species:Rattus norvegicus


Alignment Length:85 Identity:42/85 - (49%)
Similarity:58/85 - (68%) Gaps:3/85 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 KEIRLATVNE---HNKATDLWVVIDNKVYDVTKFRLEHPGGEESLVDEAGRDATKAFNDVGHSSE 64
            |:::..|:.|   |..:...||::.:||||:|||..|||||||.|.::||.|||:.|.|||||::
  Rat     7 KDVKYYTLEEIQKHKDSKSTWVILHHKVYDLTKFLEEHPGGEEVLREQAGGDATENFEDVGHSTD 71

  Fly    65 AREMLKKYYIGDLAAADIKK 84
            |||:.|.|.||:|...|..|
  Rat    72 ARELSKTYIIGELHPDDRSK 91

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3566NP_572304.5 Cyt-b5 4..77 CDD:278597 38/75 (51%)
Cyb5aNP_071581.1 Cyt-b5 13..85 CDD:395121 38/71 (54%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5274
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1566561at2759
OrthoFinder 1 1.000 - - FOG0000784
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100589
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X609
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
87.680

Return to query results.
Submit another query.