DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3566 and cyb5r4

DIOPT Version :9

Sequence 1:NP_572304.5 Gene:CG3566 / 31562 FlyBaseID:FBgn0029854 Length:117 Species:Drosophila melanogaster
Sequence 2:XP_031757575.1 Gene:cyb5r4 / 549510 XenbaseID:XB-GENE-984179 Length:523 Species:Xenopus tropicalis


Alignment Length:96 Identity:35/96 - (36%)
Similarity:47/96 - (48%) Gaps:16/96 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 RLATVNE-----HNKATDLWVVIDNKVYDVTKFRLEHPGGEESLVDEAGRDATKAFNDVGHSSEA 65
            ||..|.|     |||..|.|:.|...||::|.:...||||||.|:..||||.|..|:.|......
 Frog    53 RLIDVTEEELAQHNKKEDCWICIRGMVYNITPYMEYHPGGEEELMKAAGRDGTDLFDQVHRWVNY 117

  Fly    66 REMLKKYYIGDLAAADIKKKSPISCRHVALA 96
            ..|||:..||.:|           .:||:::
 Frog   118 ESMLKECLIGRMA-----------IKHVSIS 137

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3566NP_572304.5 Cyt-b5 4..77 CDD:278597 32/75 (43%)
cyb5r4XP_031757575.1 Cyt-b5 58..130 CDD:395121 29/71 (41%)
p23_NCB5OR 172..258 CDD:107240
cyt_b5_reduct_like 280..521 CDD:99780
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.