DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3566 and cyb5b

DIOPT Version :9

Sequence 1:NP_572304.5 Gene:CG3566 / 31562 FlyBaseID:FBgn0029854 Length:117 Species:Drosophila melanogaster
Sequence 2:NP_001011009.2 Gene:cyb5b / 496418 XenbaseID:XB-GENE-1016087 Length:141 Species:Xenopus tropicalis


Alignment Length:79 Identity:44/79 - (55%)
Similarity:58/79 - (73%) Gaps:0/79 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 LATVNEHNKATDLWVVIDNKVYDVTKFRLEHPGGEESLVDEAGRDATKAFNDVGHSSEAREMLKK 71
            |..|.:.|.|.::|:||.::|||:|||..|||||||.|.::||.|||::|.|.|||.:|||||.:
 Frog    19 LEDVRKRNTAKEIWLVIHDRVYDITKFVEEHPGGEEVLFEQAGADATESFEDAGHSIDAREMLNQ 83

  Fly    72 YYIGDLAAADIKKK 85
            ||||||...|.|.:
 Frog    84 YYIGDLHPDDCKNQ 97

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3566NP_572304.5 Cyt-b5 4..77 CDD:278597 40/69 (58%)
cyb5bNP_001011009.2 Cyt-b5 16..89 CDD:278597 40/69 (58%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1566561at2759
OrthoFinder 1 1.000 - - FOG0000784
OrthoInspector 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR19359
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X609
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
55.020

Return to query results.
Submit another query.