DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3566 and cyb5a

DIOPT Version :9

Sequence 1:NP_572304.5 Gene:CG3566 / 31562 FlyBaseID:FBgn0029854 Length:117 Species:Drosophila melanogaster
Sequence 2:NP_998300.2 Gene:cyb5a / 406409 ZFINID:ZDB-GENE-040426-2148 Length:137 Species:Danio rerio


Alignment Length:89 Identity:47/89 - (52%)
Similarity:58/89 - (65%) Gaps:2/89 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 KEIRLATVNEHNKATDLWVVIDNKVYDVTKFRLEHPGGEESLVDEAGRDATKAFNDVGHSSEARE 67
            |..||:.|.|.|.....|::|.|||||||||..|||||||.|.::||.|||::|.|||||::|||
Zfish    12 KYYRLSEVEERNSFKSTWIIIHNKVYDVTKFLEEHPGGEEVLREQAGGDATESFEDVGHSTDARE 76

  Fly    68 MLKKYYIGDLAAADIKK--KSPIS 89
            |.....||::...|..|  |.|.|
Zfish    77 MASSMLIGEVHPDDRDKIAKPPES 100

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3566NP_572304.5 Cyt-b5 4..77 CDD:278597 41/72 (57%)
cyb5aNP_998300.2 Cyt-b5 15..87 CDD:306642 41/71 (58%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1566561at2759
OrthoFinder 1 1.000 - - FOG0000784
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100589
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R279
SonicParanoid 1 1.000 - - X609
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
76.850

Return to query results.
Submit another query.