DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3566 and cyb5b

DIOPT Version :9

Sequence 1:NP_572304.5 Gene:CG3566 / 31562 FlyBaseID:FBgn0029854 Length:117 Species:Drosophila melanogaster
Sequence 2:NP_998041.1 Gene:cyb5b / 405812 ZFINID:ZDB-GENE-040426-2614 Length:153 Species:Danio rerio


Alignment Length:121 Identity:52/121 - (42%)
Similarity:74/121 - (61%) Gaps:23/121 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 KEIRLATVNEHNKATDLWVVIDNKVYDVTKFRLEHPGGEESLVDEAGRDATKAFNDVGHSSEARE 67
            ||:::     ||...|.|::|.:||||:|.|..|||||||.|:::||.|||::|.|||||::|||
Zfish    33 KEVQV-----HNMGKDTWLIIHDKVYDITSFMEEHPGGEEVLLEQAGADATESFEDVGHSTDARE 92

  Fly    68 MLKKYYIGDLAAADIKKKSPISCRHVAL---------------ALGAAFIGISLVY 108
            ||::||||:|...|.||:|.   :.|.:               |:.|..:||...|
Zfish    93 MLQQYYIGELHMDDRKKESK---KEVYITTSKDSRSWSTWFIPAIAAVLVGIMYRY 145

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3566NP_572304.5 Cyt-b5 4..77 CDD:278597 40/72 (56%)
cyb5bNP_998041.1 Cyt-b5 29..102 CDD:278597 41/73 (56%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170595163
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1566561at2759
OrthoFinder 1 1.000 - - FOG0000784
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100589
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X609
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
65.750

Return to query results.
Submit another query.