DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3566 and Cyt-b5

DIOPT Version :9

Sequence 1:NP_572304.5 Gene:CG3566 / 31562 FlyBaseID:FBgn0029854 Length:117 Species:Drosophila melanogaster
Sequence 2:NP_610294.1 Gene:Cyt-b5 / 35688 FlyBaseID:FBgn0264294 Length:134 Species:Drosophila melanogaster


Alignment Length:88 Identity:44/88 - (50%)
Similarity:63/88 - (71%) Gaps:3/88 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 SKEIRLATVNEHNKATDLWVVIDNKVYDVTKFRLEHPGGEESLVDEAGRDATKAFNDVGHSSEAR 66
            :|....|.|.:||...|.|::|.|.:||||.|..|||||||.|:::||:|||:.|.|||||::||
  Fly     6 TKTFTRAEVAKHNTNKDTWLLIHNNIYDVTAFLNEHPGGEEVLIEQAGKDATENFEDVGHSNDAR 70

  Fly    67 EMLKKYYIGDLAAAD---IKKKS 86
            :|:|||.||:|..::   :.:||
  Fly    71 DMMKKYKIGELVESERTSVAQKS 93

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3566NP_572304.5 Cyt-b5 4..77 CDD:278597 40/72 (56%)
Cyt-b5NP_610294.1 Cyt-b5 8..81 CDD:278597 40/72 (56%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45469161
Domainoid 1 1.000 89 1.000 Domainoid score I2097
eggNOG 1 0.900 - - E1_COG5274
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D149487at50557
OrthoFinder 1 1.000 - - FOG0000784
OrthoInspector 1 1.000 - - otm46547
orthoMCL 1 0.900 - - OOG6_100589
Panther 1 1.100 - - P PTHR19359
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R279
SonicParanoid 1 1.000 - - X609
1110.780

Return to query results.
Submit another query.