DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3566 and oca8

DIOPT Version :9

Sequence 1:NP_572304.5 Gene:CG3566 / 31562 FlyBaseID:FBgn0029854 Length:117 Species:Drosophila melanogaster
Sequence 2:NP_587997.1 Gene:oca8 / 2538772 PomBaseID:SPCC16A11.10c Length:129 Species:Schizosaccharomyces pombe


Alignment Length:98 Identity:46/98 - (46%)
Similarity:64/98 - (65%) Gaps:8/98 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 KEIRLATVNEHNKATDLWVVIDNKVYDVTKFRLEHPGGEESLVDEAGRDATKAFNDVGHSSEARE 67
            |.|.:..|.:||...||::|:.:||||::||...||||||.|||.|||||:..|.|||||.:|:|
pombe     4 KTITVEEVLKHNTRDDLYIVVKDKVYDISKFLDAHPGGEEVLVDLAGRDASGPFEDVGHSEDAQE 68

  Fly    68 MLKKYYIGDLAAADIKKKSPISCRHVALALGAA 100
            :|:|:|||:|...:...:.|.:        |||
pombe    69 LLEKFYIGNLLRTEDGPQLPTT--------GAA 93

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3566NP_572304.5 Cyt-b5 4..77 CDD:278597 40/72 (56%)
oca8NP_587997.1 CYB5 <2..128 CDD:227599 46/98 (47%)
Cyt-b5 5..78 CDD:278597 40/72 (56%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 89 1.000 Domainoid score I2097
eggNOG 1 0.900 - - E1_COG5274
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000784
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100589
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R279
SonicParanoid 1 1.000 - - X609
TreeFam 1 0.960 - -
87.700

Return to query results.
Submit another query.