DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3566 and Cyb5r4

DIOPT Version :9

Sequence 1:NP_572304.5 Gene:CG3566 / 31562 FlyBaseID:FBgn0029854 Length:117 Species:Drosophila melanogaster
Sequence 2:NP_596918.3 Gene:Cyb5r4 / 171015 RGDID:621834 Length:520 Species:Rattus norvegicus


Alignment Length:87 Identity:31/87 - (35%)
Similarity:45/87 - (51%) Gaps:3/87 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 EIRLATVNEHNKATDLWVVIDNKVYDVTKFRLEHPGGEESLVDEAGRDATKAFNDVGHSSEAREM 68
            |:....:.:|||..|.|:.|...||:|:.:...|||||:.|:..||.|.|..||:|........|
  Rat    56 EVTEEELKKHNKKDDCWICIRGFVYNVSPYMEYHPGGEDELMRAAGADGTDLFNEVHRWVNYESM 120

  Fly    69 LKKYYIGDLAAADIKKKSPISC 90
            ||:..:|.:|   :|...|..|
  Rat   121 LKECLVGRMA---VKPAVPKDC 139

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3566NP_572304.5 Cyt-b5 4..77 CDD:278597 27/72 (38%)
Cyb5r4NP_596918.3 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..27
Cyt-b5 56..128 CDD:278597 26/71 (37%)
p23_NCB5OR 169..255 CDD:107240
cyt_b5_reduct_like 277..518 CDD:99780
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5274
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.