DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3566 and Cyb5r4

DIOPT Version :10

Sequence 1:NP_572304.5 Gene:CG3566 / 31562 FlyBaseID:FBgn0029854 Length:117 Species:Drosophila melanogaster
Sequence 2:NP_596918.3 Gene:Cyb5r4 / 171015 RGDID:621834 Length:520 Species:Rattus norvegicus


Alignment Length:87 Identity:31/87 - (35%)
Similarity:45/87 - (51%) Gaps:3/87 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 EIRLATVNEHNKATDLWVVIDNKVYDVTKFRLEHPGGEESLVDEAGRDATKAFNDVGHSSEAREM 68
            |:....:.:|||..|.|:.|...||:|:.:...|||||:.|:..||.|.|..||:|........|
  Rat    56 EVTEEELKKHNKKDDCWICIRGFVYNVSPYMEYHPGGEDELMRAAGADGTDLFNEVHRWVNYESM 120

  Fly    69 LKKYYIGDLAAADIKKKSPISC 90
            ||:..:|.:|   :|...|..|
  Rat   121 LKECLVGRMA---VKPAVPKDC 139

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3566NP_572304.5 Cyt-b5 6..78 CDD:459698 26/71 (37%)
Cyb5r4NP_596918.3 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..27
Cyt-b5 58..130 CDD:459698 26/71 (37%)
p23_NCB5OR 169..255 CDD:107240
cyt_b5_reduct_like 277..518 CDD:99780
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.