DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3566 and CYB5A

DIOPT Version :9

Sequence 1:NP_572304.5 Gene:CG3566 / 31562 FlyBaseID:FBgn0029854 Length:117 Species:Drosophila melanogaster
Sequence 2:NP_683725.1 Gene:CYB5A / 1528 HGNCID:2570 Length:134 Species:Homo sapiens


Alignment Length:87 Identity:43/87 - (49%)
Similarity:58/87 - (66%) Gaps:2/87 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 KEIRLATVNEHNKATDLWVVIDNKVYDVTKFRLEHPGGEESLVDEAGRDATKAFNDVGHSSEARE 67
            |...|..:.:||.:...|:::.:||||:|||..|||||||.|.::||.|||:.|.|||||::|||
Human    10 KYYTLEEIQKHNHSKSTWLILHHKVYDLTKFLEEHPGGEEVLREQAGGDATENFEDVGHSTDARE 74

  Fly    68 MLKKYYIGDLAAADIKK--KSP 87
            |.|.:.||:|...|..|  |.|
Human    75 MSKTFIIGELHPDDRPKLNKPP 96

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3566NP_572304.5 Cyt-b5 4..77 CDD:278597 37/72 (51%)
CYB5ANP_683725.1 Cyt-b5 13..85 CDD:306642 37/71 (52%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5274
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1566561at2759
OrthoFinder 1 1.000 - - FOG0000784
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100589
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X609
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
87.680

Return to query results.
Submit another query.