powered by:
Protein Alignment CG3566 and CYB5D1
DIOPT Version :9
Sequence 1: | NP_572304.5 |
Gene: | CG3566 / 31562 |
FlyBaseID: | FBgn0029854 |
Length: | 117 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_653208.2 |
Gene: | CYB5D1 / 124637 |
HGNCID: | 26516 |
Length: | 228 |
Species: | Homo sapiens |
Alignment Length: | 52 |
Identity: | 19/52 - (36%) |
Similarity: | 30/52 - (57%) |
Gaps: | 2/52 - (3%) |
- Green bases have known domain annotations that are detailed below.
Fly 8 ATVNEHNKATDLWVVIDNKVYDVTKFRLEHPGG--EESLVDEAGRDATKAFN 57
|.|.:||:..||||....:|||:|....|:.|. .:.:|:.||:|.:..|:
Human 23 AEVAQHNRPEDLWVSYLGRVYDLTSLAQEYKGNLLLKPIVEVAGQDISHWFD 74
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_COG5274 |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
User_Submission |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.900 |
|
Return to query results.
Submit another query.