DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3781 and AT3G54130

DIOPT Version :9

Sequence 1:NP_572303.4 Gene:CG3781 / 31560 FlyBaseID:FBgn0029853 Length:221 Species:Drosophila melanogaster
Sequence 2:NP_190981.1 Gene:AT3G54130 / 824580 AraportID:AT3G54130 Length:280 Species:Arabidopsis thaliana


Alignment Length:212 Identity:55/212 - (25%)
Similarity:87/212 - (41%) Gaps:54/212 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    39 IYHERQTRHLCGLHALNNLFQGPDMFSKSELDDYCTTL-----------------TPRNWL--NP 84
            :|||.|..:||.:|.:|.:.||| .||:.:|......|                 .|.::|  ..
plant    10 LYHEVQESNLCAVHCVNTVLQGP-FFSEFDLAAVAADLDGKERQVMLEGAAVGGFAPGDFLAEES 73

  Fly    85 HRSWIGWGNYDVNVIMYALQQRNCEAVWFDRRRDPHCLNLSVIFGFILNV----PAQMSLGYYIP 145
            |...:| |::.:.|:..||:      ||          :|.||   .||.    |||:.......
plant    74 HNVSLG-GDFSIQVLQKALE------VW----------DLQVI---PLNCPDAEPAQIDPELESA 118

  Fly   146 LPFHMR-HWLALRRLNGSYYNLDSKLREPKCLGTEQQFLEFLATQLQMDHELFLV---LDEETDC 206
            ...|:. ||..:|::||.:||.||.|..|:.| ::.....||.:.......:|:|   ..:|...
plant   119 FICHLHDHWFCIRKVNGEWYNFDSLLAAPQHL-SKFYLSAFLDSLKGAGWSIFIVKGNFPQECPM 182

  Fly   207 KDKSQQ-----RWLLPQ 218
            ...|:.     :||.|:
plant   183 SSSSEASNSFGQWLSPE 199

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3781NP_572303.4 Josephin 44..184 CDD:280299 43/163 (26%)
AT3G54130NP_190981.1 Josephin 15..170 CDD:396601 45/176 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 47 1.000 Inparanoid score I2664
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1482722at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.970

Return to query results.
Submit another query.