DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3781 and Josd1

DIOPT Version :9

Sequence 1:NP_572303.4 Gene:CG3781 / 31560 FlyBaseID:FBgn0029853 Length:221 Species:Drosophila melanogaster
Sequence 2:NP_083068.1 Gene:Josd1 / 74158 MGIID:1921408 Length:202 Species:Mus musculus


Alignment Length:181 Identity:80/181 - (44%)
Similarity:116/181 - (64%) Gaps:7/181 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    36 PHGIYHERQTRHLCGLHALNNLFQGPDMFSKSELDDYCTTLTPRNWLNPH-RSWIGWGNYDVNVI 99
            |..||||:|.|.||.||||||:||..:.|::..|.:....|:|...:.|| :|.:|.||||||||
Mouse    23 PPQIYHEKQRRELCALHALNNVFQDSNAFTRETLQEIFQRLSPNTMVTPHKKSMLGNGNYDVNVI 87

  Fly   100 MYALQQRNCEAVWFDRRRDPHCLNLSVIFGFILNVPAQMSLGYYIPLPFHMRHWLALRRLNGSYY 164
            |.|||.:..||||:|:|||...:.|:.:.|||:|:|:.:..| .:.||...:||:.:|.:.|:||
Mouse    88 MAALQTKGYEAVWWDKRRDVGVIALTNVMGFIMNLPSSLCWG-PLKLPLKRQHWICVREVGGAYY 151

  Fly   165 NLDSKLREPKCLGTEQQFLEFLATQLQ-MDHELFLVLDEETDCKDKSQQRW 214
            ||||||:.|:.:|.|.:..:||...|: .:.||.||:.||.:    :.|.|
Mouse   152 NLDSKLKMPEWIGGESELRKFLKYHLRGKNCELLLVVPEEVE----AHQSW 198

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3781NP_572303.4 Josephin 44..184 CDD:280299 64/140 (46%)
Josd1NP_083068.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..22
Josephin 31..173 CDD:280299 64/142 (45%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167844424
Domainoid 1 1.000 145 1.000 Domainoid score I4559
eggNOG 1 0.900 - - E1_KOG2934
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 160 1.000 Inparanoid score I4224
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG59780
OrthoDB 1 1.010 - - D1482722at2759
OrthoFinder 1 1.000 - - FOG0002676
OrthoInspector 1 1.000 - - otm42708
orthoMCL 1 0.900 - - OOG6_104335
Panther 1 1.100 - - LDO PTHR13291
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R8572
SonicParanoid 1 1.000 - - X1788
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1514.800

Return to query results.
Submit another query.