DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3781 and josd2

DIOPT Version :9

Sequence 1:NP_572303.4 Gene:CG3781 / 31560 FlyBaseID:FBgn0029853 Length:221 Species:Drosophila melanogaster
Sequence 2:NP_001037929.1 Gene:josd2 / 733548 XenbaseID:XB-GENE-5740260 Length:184 Species:Xenopus tropicalis


Alignment Length:152 Identity:79/152 - (51%)
Similarity:104/152 - (68%) Gaps:2/152 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly    35 MPHGIYHERQTRHLCGLHALNNLFQGPDMFSKSELDDYCTTLTPRNWLNPHRSWIGWGNYDVNVI 99
            |...::||||...||.:||||||.|.|: ||....::.|..|.|.:.:|||||.:|.||||||||
 Frog     1 MTESVFHERQRLELCAVHALNNLLQKPE-FSHQRAEEICRGLAPNSMINPHRSLLGTGNYDVNVI 64

  Fly   100 MYALQQRNCEAVWFDRRRDPHCLNLSVIFGFILNVPAQMSLGYYIPLPFHMRHWLALRRLNGSYY 164
            |.|||..:..|||:|:||....|.||.|||||||:|:.:||| ::.||...:||:|:|::.|.||
 Frog    65 MAALQTMDYAAVWWDKRRSLESLVLSEIFGFILNIPSPVSLG-FLSLPITRKHWIAVRQIEGVYY 128

  Fly   165 NLDSKLREPKCLGTEQQFLEFL 186
            ||||||:.|..||..::..|||
 Frog   129 NLDSKLKAPVKLGGPKELKEFL 150

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3781NP_572303.4 Josephin 44..184 CDD:280299 72/139 (52%)
josd2NP_001037929.1 Josephin 10..151 CDD:366917 75/143 (52%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 150 1.000 Domainoid score I4355
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 - - H26696
Inparanoid 1 1.050 161 1.000 Inparanoid score I4128
OMA 1 1.010 - - QHG59780
OrthoDB 1 1.010 - - D1482722at2759
OrthoFinder 1 1.000 - - FOG0002676
OrthoInspector 1 1.000 - - otm47812
Panther 1 1.100 - - O PTHR13291
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X1788
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
1010.080

Return to query results.
Submit another query.