DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3781 and Josd2

DIOPT Version :9

Sequence 1:NP_572303.4 Gene:CG3781 / 31560 FlyBaseID:FBgn0029853 Length:221 Species:Drosophila melanogaster
Sequence 2:XP_006541134.1 Gene:Josd2 / 66124 MGIID:1913374 Length:227 Species:Mus musculus


Alignment Length:184 Identity:91/184 - (49%)
Similarity:112/184 - (60%) Gaps:13/184 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    36 PHGIYHERQTRHLCGLHALNNLFQGPDMFSKSELDDYCTTLTPRNWLNPHRSWIGWGNYDVNVIM 100
            |..:|||||...||.:|||||:.| ..:||:...|:.|..|.|.:.||||||.:|.|||||||||
Mouse    50 PPSVYHERQRLELCAVHALNNVLQ-EQLFSQEAADEICKRLAPDSRLNPHRSLLGTGNYDVNVIM 113

  Fly   101 YALQQRNCEAVWFDRRRDPHCLNLSVIFGFILNVPAQMSLGYYIPLPFHMRHWLALRRLNGSYYN 165
            .|||.....|||:||||....|.|..:.|.|||:|:.:||| .:.||...|||:|||:::|.|||
Mouse   114 AALQGLGLAAVWWDRRRPLSQLALPQVLGLILNLPSPVSLG-LLSLPLRRRHWVALRQVDGIYYN 177

  Fly   166 LDSKLREPKCLGTEQQFLEFLATQL-QMDHELFLVLD---EETDCKDKSQQRWL 215
            ||||||.|:.||.|.....|||..| |...|:.||:.   ||..|       ||
Mouse   178 LDSKLRAPEALGDEDGVRTFLAAALAQGLCEVLLVVTKEVEEAGC-------WL 224

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3781NP_572303.4 Josephin 44..184 CDD:280299 73/139 (53%)
Josd2XP_006541134.1 Josephin 58..205 CDD:366917 77/148 (52%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167844425
Domainoid 1 1.000 145 1.000 Domainoid score I4559
eggNOG 1 0.900 - - E1_KOG2934
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 - - H26696
Inparanoid 1 1.050 160 1.000 Inparanoid score I4224
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG59780
OrthoDB 1 1.010 - - D1482722at2759
OrthoFinder 1 1.000 - - FOG0002676
OrthoInspector 1 1.000 - - otm42708
orthoMCL 1 0.900 - - OOG6_104335
Panther 1 1.100 - - O PTHR13291
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R8572
SonicParanoid 1 1.000 - - X1788
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1615.800

Return to query results.
Submit another query.