DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3781 and Atxn3

DIOPT Version :9

Sequence 1:NP_572303.4 Gene:CG3781 / 31560 FlyBaseID:FBgn0029853 Length:221 Species:Drosophila melanogaster
Sequence 2:XP_006240547.1 Gene:Atxn3 / 60331 RGDID:621567 Length:382 Species:Rattus norvegicus


Alignment Length:220 Identity:56/220 - (25%)
Similarity:82/220 - (37%) Gaps:74/220 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly    39 IYHERQTRHLCGLHALNNLFQGPDMFSKSEL----------------------DDYCTTL----- 76
            |:||:|...||..|.||||.|| :.||..||                      :||.|.|     
  Rat     4 IFHEKQEGSLCAQHCLNNLLQG-EYFSPVELSSIAHQLDEEERLRMAEGGVTSEDYRTFLQQPSG 67

  Fly    77 -----------TPRNWLNPHR-SWIGWG-----NYDVNVIMYALQQRNCEAVWFDR------RRD 118
                       :|.:...|.| |.:..|     .....||..||:....|.:.|:.      |.|
  Rat    68 NMDDSGFFSIQSPYSLAFPPRTSLVHLGRPSGPELRAEVISNALKVWGLELILFNSPEYQRLRID 132

  Fly   119 PHCLNLSVIFGFILNVPAQMSLGYYIPLPFHMRHWLALRRLNGSYYNLDSKLREPKCLGTEQQFL 183
            |  :|..   .||.|               :..||..:|:|...::||:|.|..|:.:  ...:|
  Rat   133 P--INER---SFICN---------------YKEHWFTVRKLGKQWFNLNSLLTGPELI--SDTYL 175

  Fly   184 EFLATQLQMD-HELFLVLDEETDCK 207
            .....|||.: :.:|:|..:..||:
  Rat   176 ALFLAQLQQEGYSIFVVKGDLPDCE 200

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3781NP_572303.4 Josephin 44..184 CDD:280299 45/189 (24%)
Atxn3XP_006240547.1 Josephin 9..190 CDD:280299 49/203 (24%)
SUIM_assoc 291..348 CDD:293225
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1482722at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.