DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3781 and ATXN3

DIOPT Version :9

Sequence 1:NP_572303.4 Gene:CG3781 / 31560 FlyBaseID:FBgn0029853 Length:221 Species:Drosophila melanogaster
Sequence 2:NP_004984.2 Gene:ATXN3 / 4287 HGNCID:7106 Length:361 Species:Homo sapiens


Alignment Length:198 Identity:53/198 - (26%)
Similarity:79/198 - (39%) Gaps:57/198 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    39 IYHERQTRHLCGLHALNNLFQGPDMFSKSEL----------------------DDYCTTLTPRNW 81
            |:||:|...||..|.||||.|| :.||..||                      :||.|.|.    
Human     4 IFHEKQEGSLCAQHCLNNLLQG-EYFSPVELSSIAHQLDEEERMRMAEGGVTSEDYRTFLQ---- 63

  Fly    82 LNPHRSWIGWGNYDVNVIMYALQQRNCEAVWFDR------RRDPHCLNLSVIFGFILNVPAQMSL 140
             .|..:....|.:.:.||..||:....|.:.|:.      |.||  :|..   .||.|       
Human    64 -QPSGNMDDSGFFSIQVISNALKVWGLELILFNSPEYQRLRIDP--INER---SFICN------- 115

  Fly   141 GYYIPLPFHMRHWLALRRLNGSYYNLDSKLREPKCLGTEQQFLEFLATQLQMD-HELFLVLDEET 204
                    :..||..:|:|...::||:|.|..|:.:  ...:|.....|||.: :.:|:|..:..
Human   116 --------YKEHWFTVRKLGKQWFNLNSLLTGPELI--SDTYLALFLAQLQQEGYSIFVVKGDLP 170

  Fly   205 DCK 207
            ||:
Human   171 DCE 173

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3781NP_572303.4 Josephin 44..184 CDD:280299 42/167 (25%)
ATXN3NP_004984.2 Josephin 11..163 CDD:307972 45/179 (25%)
SUIM_assoc 264..328 CDD:318760
polyglutamine repeat 292..305
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1482722at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.