Sequence 1: | NP_572303.4 | Gene: | CG3781 / 31560 | FlyBaseID: | FBgn0029853 | Length: | 221 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_004984.2 | Gene: | ATXN3 / 4287 | HGNCID: | 7106 | Length: | 361 | Species: | Homo sapiens |
Alignment Length: | 198 | Identity: | 53/198 - (26%) |
---|---|---|---|
Similarity: | 79/198 - (39%) | Gaps: | 57/198 - (28%) |
- Green bases have known domain annotations that are detailed below.
Fly 39 IYHERQTRHLCGLHALNNLFQGPDMFSKSEL----------------------DDYCTTLTPRNW 81
Fly 82 LNPHRSWIGWGNYDVNVIMYALQQRNCEAVWFDR------RRDPHCLNLSVIFGFILNVPAQMSL 140
Fly 141 GYYIPLPFHMRHWLALRRLNGSYYNLDSKLREPKCLGTEQQFLEFLATQLQMD-HELFLVLDEET 204
Fly 205 DCK 207 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG3781 | NP_572303.4 | Josephin | 44..184 | CDD:280299 | 42/167 (25%) |
ATXN3 | NP_004984.2 | Josephin | 11..163 | CDD:307972 | 45/179 (25%) |
SUIM_assoc | 264..328 | CDD:318760 | |||
polyglutamine repeat | 292..305 | ||||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 1 | 1.010 | - | - | D1482722at2759 | |
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.920 |