DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3781 and josd1

DIOPT Version :9

Sequence 1:NP_572303.4 Gene:CG3781 / 31560 FlyBaseID:FBgn0029853 Length:221 Species:Drosophila melanogaster
Sequence 2:NP_001121477.1 Gene:josd1 / 100158575 XenbaseID:XB-GENE-1000778 Length:201 Species:Xenopus tropicalis


Alignment Length:182 Identity:81/182 - (44%)
Similarity:117/182 - (64%) Gaps:7/182 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    35 MPHGIYHERQTRHLCGLHALNNLFQGPDMFSKSELDDYCTTLTPRNWLNPH-RSWIGWGNYDVNV 98
            :|..||||:|.|.||.||||||:||....|::..|.:....|:|...:.|| ::.:|.|||||||
 Frog    21 LPPQIYHEKQRRELCALHALNNVFQDAGAFTRETLQEIFQRLSPNTLVTPHKKNVLGNGNYDVNV 85

  Fly    99 IMYALQQRNCEAVWFDRRRDPHCLNLSVIFGFILNVPAQMSLGYYIPLPFHMRHWLALRRLNGSY 163
            ||.|||.:..||||:|:|||.:.:.||.:.|||:|:|:.:|.| .:.||...:||:.:|.:.|:|
 Frog    86 IMAALQTKGYEAVWWDKRRDVNLICLSNVTGFIMNLPSSLSWG-PLKLPLKRQHWICVREVGGNY 149

  Fly   164 YNLDSKLREPKCLGTEQQFLEFLATQLQ-MDHELFLVLDEETDCKDKSQQRW 214
            |||||||:.|:.:|:|....:|....|: .:.||.||:.||.:.    .|||
 Frog   150 YNLDSKLKRPEWIGSEDDLRKFFRYHLRGKNCELLLVVPEEVEV----HQRW 197

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3781NP_572303.4 Josephin 44..184 CDD:280299 65/140 (46%)
josd1NP_001121477.1 Josephin 30..173 CDD:366917 66/143 (46%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 150 1.000 Domainoid score I4355
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1482722at2759
OrthoFinder 1 1.000 - - FOG0002676
OrthoInspector 1 1.000 - - otm47812
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R8572
SonicParanoid 1 1.000 - - X1788
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
66.040

Return to query results.
Submit another query.