Sequence 1: | NP_511058.1 | Gene: | Spx / 31558 | FlyBaseID: | FBgn0015818 | Length: | 347 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_659197.2 | Gene: | Rbm7 / 67010 | MGIID: | 1914260 | Length: | 265 | Species: | Mus musculus |
Alignment Length: | 228 | Identity: | 60/228 - (26%) |
---|---|---|---|
Similarity: | 101/228 - (44%) | Gaps: | 52/228 - (22%) |
- Green bases have known domain annotations that are detailed below.
Fly 7 AERNQDATIYAGGLDDKVSETLLWELFVQAGPVVNVHMPKDRVTQMHQGYGFVEFLSEEDADYGI 71
Fly 72 KIMNMIKLYGKPIRV--NKASAHQKNLDVGANI---FIGNLDVEVDEKLLYDTFSAFGVILQTPK 131
Fly 132 IMR----DPETGKSKS-----FAFINFA----------------------SFEASDAA---MDAM 162
Fly 163 NGQ--------YLCNRPISVSYAFKKDHKGERH 187 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Spx | NP_511058.1 | RRM1_SF3B4 | 15..88 | CDD:240780 | 32/74 (43%) |
RRM2_SF3B4 | 99..181 | CDD:240781 | 19/126 (15%) | ||
Rbm7 | NP_659197.2 | RRM | <9..>101 | CDD:223796 | 37/93 (40%) |
RRM_RBM7 | 9..83 | CDD:241036 | 34/74 (46%) | ||
ZCCHC8 binding. /evidence=ECO:0000250|UniProtKB:Q9Y580 | 25..35 | 7/9 (78%) | |||
ZCCHC8 binding. /evidence=ECO:0000250|UniProtKB:Q9Y580 | 59..76 | 5/16 (31%) | |||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 91..125 | 6/36 (17%) | |||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 166..224 | 11/58 (19%) | |||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 237..265 | ||||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 1 | 1.010 | - | - | D491103at33208 | |
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.920 |