DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spx and Rbm7

DIOPT Version :9

Sequence 1:NP_511058.1 Gene:Spx / 31558 FlyBaseID:FBgn0015818 Length:347 Species:Drosophila melanogaster
Sequence 2:NP_659197.2 Gene:Rbm7 / 67010 MGIID:1914260 Length:265 Species:Mus musculus


Alignment Length:228 Identity:60/228 - (26%)
Similarity:101/228 - (44%) Gaps:52/228 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 AERNQDATIYAGGLDDKVSETLLWELFVQAGPVVNVHMPKDRVTQMHQGYGFVEFLSEEDADYGI 71
            |....|.|::.|.|:.||:|.||:|||.|||||:.|.:|||:..::.| :.||.|..|....|.:
Mouse     4 AAAEADRTLFVGNLETKVTEELLFELFHQAGPVIKVKIPKDKDGKLKQ-FAFVNFKHEVSVPYAM 67

  Fly    72 KIMNMIKLYGKPIRV--NKASAHQKNLDVGANI---FIGNLDVEVDEKLLYDTFSAFGVILQTPK 131
            .::|.|||:|:||::  ...|:|... |...:.   .:|||.........|:  ...|.:..|.:
Mouse    68 NLLNGIKLFGRPIKIQFRSGSSHASQ-DASVSYPQHHVGNLSPTSTSPNSYE--RTVGNVSPTAQ 129

  Fly   132 IMR----DPETGKSKS-----FAFINFA----------------------SFEASDAA---MDAM 162
            :::    .||..:.::     |..:::|                      :|..|.::   .||:
Mouse   130 MVQRSFSSPEDYQRQAVMNSVFRQMSYAGKFGSPHADQLGFSPSAQPHGHTFNQSSSSQWRQDAL 194

  Fly   163 NGQ--------YLCNRPISVSYAFKKDHKGERH 187
            :.|        ||.:|..|....: .||..:.|
Mouse   195 SSQRKRQNSHPYLADRHYSREQRY-SDHGSDYH 226

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SpxNP_511058.1 RRM1_SF3B4 15..88 CDD:240780 32/74 (43%)
RRM2_SF3B4 99..181 CDD:240781 19/126 (15%)
Rbm7NP_659197.2 RRM <9..>101 CDD:223796 37/93 (40%)
RRM_RBM7 9..83 CDD:241036 34/74 (46%)
ZCCHC8 binding. /evidence=ECO:0000250|UniProtKB:Q9Y580 25..35 7/9 (78%)
ZCCHC8 binding. /evidence=ECO:0000250|UniProtKB:Q9Y580 59..76 5/16 (31%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 91..125 6/36 (17%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 166..224 11/58 (19%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 237..265
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D491103at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.