DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spx and hfp

DIOPT Version :9

Sequence 1:NP_511058.1 Gene:Spx / 31558 FlyBaseID:FBgn0015818 Length:347 Species:Drosophila melanogaster
Sequence 2:NP_525123.2 Gene:hfp / 38173 FlyBaseID:FBgn0028577 Length:637 Species:Drosophila melanogaster


Alignment Length:340 Identity:84/340 - (24%)
Similarity:136/340 - (40%) Gaps:60/340 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 IYAGGLDDKVSETLLWELFVQAGPVVNVHMPKDRVTQMHQGYGFVEFLSEEDADYGIKIMNMIKL 79
            :|.|.:..::.|..:...|...||:.:::|..|.:||.|:|:.|||:...|.|...::.||...:
  Fly   132 VYVGSISFELKEDTIRVAFTPFGPIKSINMSWDPITQKHKGFAFVEYEIPEGAQLALEQMNGALM 196

  Fly    80 YGKPIRVNKAS----AHQ---------KNLDVGANIFIGNLDVEVDEKLLYDTFSAFGVILQTPK 131
            .|:.|:|.:.|    |.|         |:.:   .|::.::..::.|:.:...|.|||.||.. |
  Fly   197 GGRNIKVGRPSNMPQAQQVIDEVQEEAKSFN---RIYVASIHPDLSEEDIKSVFEAFGPILYC-K 257

  Fly   132 IMRDPETGKSKSFAFINFASFEASDAAMDAMN-----GQYLCNRPISVSYAFKKDHKGERHGSAA 191
            :.:.......|.:.||.:|:.:|.|.|:.:||     ||.|                  |.|.:.
  Fly   258 LAQGTSLHTHKGYGFIEYANKQAMDEAIASMNLFDLGGQLL------------------RVGRSI 304

  Fly   192 ERLLAAQNPSTHADRPHQLFADAPVQTMMPQMPGQIPAQ-MPGQMMPPPMMAPPPPV-----VPV 250
            ....|...|:|::..|......|...|...|....:.:. :.|.....|:||....|     :||
  Fly   305 TPPNALACPTTNSTMPTAAAVAAAAATAKIQALDAVASNAVLGLSQNTPVMAAGAVVTKVGAMPV 369

  Fly   251 SNNNMGMLAPPPPVPQPAPFPATIPPPPLPPMTGGQPPLPPAMGIPPPPRMMQPNAWAPPGMPAP 315
            .:......|..|.:.|.|  ||.:||......|   |..|..:|:|         |...|.....
  Fly   370 VSAATSAAALHPALAQAA--PALLPPGIFQAPT---PVAPSLLGVP---------AGLQPLQAVV 420

  Fly   316 PPRPPPTNWRPPPVP 330
            |..|||.....|.:|
  Fly   421 PTLPPPALLATPTLP 435

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SpxNP_511058.1 RRM1_SF3B4 15..88 CDD:240780 22/72 (31%)
RRM2_SF3B4 99..181 CDD:240781 21/86 (24%)
hfpNP_525123.2 half-pint 10..637 CDD:130706 84/340 (25%)
RRM1_PUF60 130..205 CDD:240816 22/72 (31%)
RRM2_PUF60 227..303 CDD:240817 23/97 (24%)
RRM3_UHM_PUF60 536..636 CDD:241092
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45439567
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.