DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spx and TBPH

DIOPT Version :9

Sequence 1:NP_511058.1 Gene:Spx / 31558 FlyBaseID:FBgn0015818 Length:347 Species:Drosophila melanogaster
Sequence 2:NP_001163280.1 Gene:TBPH / 37781 FlyBaseID:FBgn0025790 Length:531 Species:Drosophila melanogaster


Alignment Length:202 Identity:48/202 - (23%)
Similarity:77/202 - (38%) Gaps:36/202 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 GLDDKVSETLLWELFVQAGPVVNVHMPKDRVTQMHQGYGFVEFLSEEDADYGIKIMNMIKLYGKP 83
            ||..|.:|..|.|.|...|.|:...:.||..:...:|:|||.| ...||...: :.|...:.|:.
  Fly   113 GLPWKTTEESLREYFETYGEVLMAQIKKDTKSGQSKGFGFVRF-GSYDAQMRV-LTNRHLIDGRW 175

  Fly    84 IRV----NKASAHQKNLDVGANIFIGNLDVEVDEKLLYDTFSAFGVILQT--PKIMRDPETGKSK 142
            ..|    :|...||    |...:|:|....:::...|.:.||.||.:...  |:..|        
  Fly   176 CEVKVPNSK
GMGHQ----VPCKVFVGRCTEDINSDDLREYFSKFGEVTDVFIPRPFR-------- 228

  Fly   143 SFAFINFASFEASDAAMDAMNGQYLCNR-------PISVSYAFKKDHKGERHGSAAERLLAAQNP 200
            :|:|:.|         :|....|.||..       .:.||.|..|..:.......:....:|.:.
  Fly   229 AFSFVTF---------LDPDVAQSLCGEDHIIKGVSVHVSNAAPKAEQNRNQQVQSYNYNSANSF 284

  Fly   201 STHADRP 207
            ..|:..|
  Fly   285 GMHSYHP 291

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SpxNP_511058.1 RRM1_SF3B4 15..88 CDD:240780 21/72 (29%)
RRM2_SF3B4 99..181 CDD:240781 19/90 (21%)
TBPHNP_001163280.1 RRM1_TDP43 108..184 CDD:240767 21/72 (29%)
RRM2_TDP43 192..261 CDD:240768 18/85 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45439630
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.