DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spx and Sxl

DIOPT Version :9

Sequence 1:NP_511058.1 Gene:Spx / 31558 FlyBaseID:FBgn0015818 Length:347 Species:Drosophila melanogaster
Sequence 2:NP_001259303.1 Gene:Sxl / 3772180 FlyBaseID:FBgn0264270 Length:722 Species:Drosophila melanogaster


Alignment Length:281 Identity:73/281 - (25%)
Similarity:117/281 - (41%) Gaps:75/281 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 PIAERNQ-----DATIYAGGLDD-------------------KVSETLLWELFVQAGPVVNVHMP 45
            |:|..|.     ..::.:||.||                   .:::..|:.||...||:....:.
  Fly    85 PMASNNSLNNLCGLSLGSGGSDDLMNDPRASNTNLIVNYLPQDMTDRELYALFRAIGPINTCRIM 149

  Fly    46 KDRVTQMHQGYGFVEFLSEEDADYGIKIMNMIKLYGKPIRVNKASAHQKNLDVGANIFIGNLDVE 110
            :|..|....||.||:|.||.|:...||::|.|.:..|.::|:.|....:::. ..|:::.||...
  Fly   150 RDYKTGYSFGYAFVDFTSEMDSQRAIKVLNGITVRNKRLKVSYARPGGESIK-DTNLYVTNLPRT 213

  Fly   111 VDEKLLYDTFSAFGVILQTPKIMRDPETGKSKSFAFINFASFEASDAAMDAMN------GQYLCN 169
            :.:..|...|..:|.|:| ..|:||..||:.:..||:.:...|.:..|:.|:|      |    :
  Fly   214 ITDDQLDTIFGKYGSIVQ-KNILRDKLTGRPRGVAFVRYNKREEAQEAISALNNVIPEGG----S 273

  Fly   170 RPISVSYAFKKDHKGERHGSAAERLLAAQNPSTHADRPHQLFADAPVQTMMPQMPGQIPAQMPGQ 234
            :|:||..|       |.||.|         .:.|               .|.|| |.:||.:|  
  Fly   274 QPLSVRLA-------EEHGKA---------KAAH---------------FMSQM-GVVPANVP-- 304

  Fly   235 MMPPPMMAPPPPVVPVSNNNM 255
              |||   |.||....:..||
  Fly   305 --PPP---PQPPAHMAAAFNM 320

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SpxNP_511058.1 RRM1_SF3B4 15..88 CDD:240780 25/91 (27%)
RRM2_SF3B4 99..181 CDD:240781 24/87 (28%)
SxlNP_001259303.1 RRM1_SXL 117..197 CDD:241093 22/79 (28%)
RRM2_Hu_like 203..281 CDD:240822 23/82 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24012
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.