DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spx and tra2

DIOPT Version :10

Sequence 1:NP_511058.1 Gene:Spx / 31558 FlyBaseID:FBgn0015818 Length:347 Species:Drosophila melanogaster
Sequence 2:NP_476764.1 Gene:tra2 / 36619 FlyBaseID:FBgn0003742 Length:264 Species:Drosophila melanogaster


Alignment Length:69 Identity:22/69 - (31%)
Similarity:36/69 - (52%) Gaps:0/69 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 GLDDKVSETLLWELFVQAGPVVNVHMPKDRVTQMHQGYGFVEFLSEEDADYGIKIMNMIKLYGKP 83
            ||:...|:..:.|||.:.||:..:.|..|..||..:|:.|:.|....||.......:.|::.|:.
  Fly   103 GLNTNTSQHKVRELFNKYGPIERIQMVIDAQTQRSRGFCFIYFEKLSDARAAKDSCSGIEVDGRR 167

  Fly    84 IRVN 87
            |||:
  Fly   168 IRVD 171

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SpxNP_511058.1 RRM1_SF3B4 15..88 CDD:409771 22/69 (32%)
RRM2_SF3B4 99..181 CDD:409772
tra2NP_476764.1 RRM_TRA2 96..175 CDD:409798 22/69 (32%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.