Sequence 1: | NP_511058.1 | Gene: | Spx / 31558 | FlyBaseID: | FBgn0015818 | Length: | 347 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001259974.1 | Gene: | Rbp9 / 33498 | FlyBaseID: | FBgn0010263 | Length: | 684 | Species: | Drosophila melanogaster |
Alignment Length: | 203 | Identity: | 64/203 - (31%) |
---|---|---|---|
Similarity: | 99/203 - (48%) | Gaps: | 27/203 - (13%) |
- Green bases have known domain annotations that are detailed below.
Fly 20 LDDKVSETLLWELFVQAGPVVNVHMPKDRVTQMHQGYGFVEFLSEEDADYGIKIMNMIKLYGKPI 84
Fly 85 RVNKASAHQKNLDVGANIFIGNLDVEVDEKLLYDTFSAFGVILQTPKIMRDPETGKSKSFAFINF 149
Fly 150 -ASFEASDAAMDAMNGQYLCN--RPISVSYAFKKDHKGERHGSAAERLLAAQNPSTHADRPHQLF 211
Fly 212 A-DAPVQT 218 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Spx | NP_511058.1 | RRM1_SF3B4 | 15..88 | CDD:240780 | 24/67 (36%) |
RRM2_SF3B4 | 99..181 | CDD:240781 | 30/84 (36%) | ||
Rbp9 | NP_001259974.1 | ELAV_HUD_SF | 107..438 | CDD:273741 | 64/203 (32%) |
RRM1_Hu | 109..186 | CDD:241094 | 24/68 (35%) | ||
RRM2_Hu | 196..274 | CDD:241096 | 29/99 (29%) | ||
RRM3_Hu | 355..432 | CDD:240823 | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 1 | 0.930 | - | - | C45439635 | |
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.840 |