DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spx and Rbm7

DIOPT Version :9

Sequence 1:NP_511058.1 Gene:Spx / 31558 FlyBaseID:FBgn0015818 Length:347 Species:Drosophila melanogaster
Sequence 2:XP_038937367.1 Gene:Rbm7 / 315634 RGDID:1308017 Length:265 Species:Rattus norvegicus


Alignment Length:234 Identity:60/234 - (25%)
Similarity:96/234 - (41%) Gaps:64/234 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 AERNQDATIYAGGLDDKVSETLLWELFVQAGPVVNVHMPKDRVTQMHQGYGFVEFLSEEDADYGI 71
            |....|.|::.|.|:.||:|.||:|||.|||||:.|.:|||:..::.| :.||.|..|....|.:
  Rat     4 AAAEADRTLFVGNLETKVTEELLFELFHQAGPVIKVKIPKDKDGKLKQ-FAFVNFKHEVSVPYAM 67

  Fly    72 KIMNMIKLYGKPIRVNKASA---------------HQKNL---DVGANIF---IGNLDVEVDEKL 115
            .::|.|||:|:||::...|.               |..||   ....|.:   :||  |....::
  Rat    68 NLLNGIKLFGRPIKIQFRSGSSHLSQDASTSYPQHHMGNLSPTSTSPNSYERTVGN--VTPPAQM 130

  Fly   116 LYDTFSAFGVILQTPKIMRDPETGKS--KSFAFI----------------------NFASFEASD 156
            :..:||       ||:..:......|  :..:::                      .|....:|.
  Rat   131 VQRSFS-------TPEDYQRQAVMNSVFRQMSYVGKFGSPHADQLGFSPSVQPHGHTFNQSSSSQ 188

  Fly   157 AAMDAMNGQ--------YLCNRPISVSYAFKKDHKGERH 187
            ...||::.|        ||.:|..|....: .||..:.|
  Rat   189 WRQDAVSSQRKRQNSHPYLADRHYSREQRY-SDHGSDYH 226

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SpxNP_511058.1 RRM1_SF3B4 15..88 CDD:240780 32/72 (44%)
RRM2_SF3B4 99..181 CDD:240781 18/116 (16%)
Rbm7XP_038937367.1 RRM_RBM7 9..83 CDD:410005 34/74 (46%)
PABP-1234 <12..203 CDD:130689 50/200 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D491103at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.