DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spx and bru2

DIOPT Version :9

Sequence 1:NP_511058.1 Gene:Spx / 31558 FlyBaseID:FBgn0015818 Length:347 Species:Drosophila melanogaster
Sequence 2:NP_001036356.1 Gene:bru2 / 250811 FlyBaseID:FBgn0262475 Length:893 Species:Drosophila melanogaster


Alignment Length:387 Identity:84/387 - (21%)
Similarity:143/387 - (36%) Gaps:108/387 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 IYAGGLDDKVSETLLWELFVQAGPVVNVHMPKDRVTQMHQGYGFVEF------LSEEDADYGIKI 73
            ::.|.:.....||.|.::|.|.|||..:::.:|:||.:.:|..||.:      |..:||.:.||.
  Fly   297 MFVGQIPKTWDETRLRQMFEQFGPVHTLNVLRDKVTSISRGCCFVTYYTRKAALRAQDALHNIKT 361

  Fly    74 MNMIKLYGKPIRVNKASAHQKNLDVGANIFIGNLDVEVDEKLLYDTFSAFGVILQTPKIMRDPET 138
            ::.:.   .||::..|.:..:|   ...:|:|.|:.:..|..:...|:..|.| :...::|| :.
  Fly   362 LDGMH---HPIQMKPADSENRN---ERKLFVGMLNKKYTEADVRQLFTGHGTI-EECTVLRD-QA 418

  Fly   139 GKSKSFAFINFASFEASDAAMDAMNGQYL---CNRPISVSYAFKKDHKGERHGSAAERLLAAQNP 200
            |:||..||:.||:.:.:..|:.|::....   |:.|:.|.:|..:..|.::              
  Fly   419 GQSKGCAFVTFATKQNAIGAIKALHQSQTMEGCSAPLVVKFADTQKEKDQK-------------- 469

  Fly   201 STHADRPHQLFADAPVQTMMPQMPGQIPAQMPGQMMPPPMMAPPPPVVPVSNNNMGMLAPPPPVP 265
                 :..|:.|...:.|......|   |..|.......::|.||.....:.:....||..|.|.
  Fly   470 -----KMQQIHAFCGINTPSGATAG---AATPTINAATALIAAPPSAGRTNPSMAAALAAVPQVQ 526

  Fly   266 Q---PAPFPATIPP--------PPLPP-----------------MTGGQPP-------------- 288
            |   .|..|.|:.|        ..|.|                 ..|..|.              
  Fly   527 QAGSAATAPTTLVPLNSTTALSASLTPNLLATNAAHQGAAAAAAYLGADPAAAAHLQLYQQLHGY 591

  Fly   289 -LPPAMGIP-----PPPRMMQPNAWAPPGM---------------------PAPPPRPPPTN 323
             |.||..:|     .||.....::...||:                     .||||.|.||:
  Fly   592 GLSPAHYLPGLNFHHPPENSAHHSQHSPGIGGASAASLSAAAATAASNPLGGAPPPTPTPTS 653

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SpxNP_511058.1 RRM1_SF3B4 15..88 CDD:240780 22/78 (28%)
RRM2_SF3B4 99..181 CDD:240781 22/84 (26%)
bru2NP_001036356.1 RRM1_CELF1_2_Bruno 294..375 CDD:241075 22/80 (28%)
RRM2_Bruno_like 381..461 CDD:241080 21/81 (26%)
RRM_SF 801..892 CDD:302621
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24012
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.