DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spx and Rbm11

DIOPT Version :9

Sequence 1:NP_511058.1 Gene:Spx / 31558 FlyBaseID:FBgn0015818 Length:347 Species:Drosophila melanogaster
Sequence 2:NP_938044.1 Gene:Rbm11 / 224344 MGIID:2447622 Length:238 Species:Mus musculus


Alignment Length:285 Identity:67/285 - (23%)
Similarity:98/285 - (34%) Gaps:99/285 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 AERNQDATIYAGGLDDKVSETLLWELFVQAGPVVNVHMPKDRVTQMHQGYGFVEFLSEEDADYGI 71
            |:...|.|::.|.|:.:|.|.:|:|||:||||:..|.:.||| ....:.:|||.|...|...|.|
Mouse     4 AQEEADRTVFVGNLEARVREEILYELFLQAGPLTKVTLCKDR-DGKPKSFGFVCFKHPESVSYAI 67

  Fly    72 KIMNMIKLYGKPIRVNKASAHQKNLDVGANIFIGNLDVEVDEKLLYDTFSAFGVILQTPKIMRDP 136
            .::|.|:|||:||.|.......::                                      .:|
Mouse    68 ALLNGIRLYGRPINVQYRFGSSRS--------------------------------------SEP 94

  Fly   137 ETGKSKSFAFINFASFEASDAAMDAMNGQYLCNRPISVSYAFKKDHKGERHGSAAERLLAAQNPS 201
            .....:|.|.||..||...:.|          .|| |....|                    .|.
Mouse    95 ANQSFESCAKINSHSFRNDEMA----------GRP-SFPVPF--------------------FPI 128

  Fly   202 THADRPHQLF--------ADAPV-QTMMPQMPGQIPAQMPGQMMPPPMMAPPPPVVPVSNNNMGM 257
            |.|..|.:.|        |.:|| |....:||..:|..:||                    :..:
Mouse   129 TSAALPQEYFFFQKMPWYAHSPVLQPPFCEMPAPLPNSVPG--------------------SCAL 173

  Fly   258 LAPPPPVPQPAPFPATIPPPPLPPM 282
            ...|.|...|:.:..|..||..|.:
Mouse   174 NHSPGPEAGPSSYEWTHQPPSDPDL 198

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SpxNP_511058.1 RRM1_SF3B4 15..88 CDD:240780 31/72 (43%)
RRM2_SF3B4 99..181 CDD:240781 12/81 (15%)
Rbm11NP_938044.1 RRM <5..139 CDD:223796 49/203 (24%)
RRM_RBM11 9..83 CDD:241037 32/74 (43%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 172..238 7/27 (26%)
Bipartite nuclear localization signal. /evidence=ECO:0000305 202..237
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D491103at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.