DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spx and EEED8.12

DIOPT Version :9

Sequence 1:NP_511058.1 Gene:Spx / 31558 FlyBaseID:FBgn0015818 Length:347 Species:Drosophila melanogaster
Sequence 2:NP_495021.1 Gene:EEED8.12 / 173922 WormBaseID:WBGene00017140 Length:197 Species:Caenorhabditis elegans


Alignment Length:131 Identity:42/131 - (32%)
Similarity:64/131 - (48%) Gaps:7/131 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    61 FLSEEDADYGI--KIMN-MIKLYGKPIRVNKASAHQKNLDVGANIFIGNLDVEVDEKLLYDTFSA 122
            |..|.:|:..|  :|.| |.|.......|......||.:| ..::||||:|.....:.:.:.|..
 Worm    20 FEMEIEAESAILEQIQNKMAKNLESAAYVPPTEEEQKAID-AKSVFIGNVDFNSTIEEVEEHFKG 83

  Fly   123 FGVILQTPKIMRDPETGKSKSFAFINFASFEASDAAMDAMNGQYLCNRPISVSYAFKKDHKGERH 187
            .|.|::| .|.:|..|.|.|:||:|.|....:.:.|: .|||....:|||.|: |.:.:..|..|
 Worm    84 CGHIVRT-TIPKDKFTKKQKNFAYIEFDDSSSIENAL-VMNGSLFRSRPIVVT-AKRTNIPGMGH 145

  Fly   188 G 188
            |
 Worm   146 G 146

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SpxNP_511058.1 RRM1_SF3B4 15..88 CDD:240780 9/29 (31%)
RRM2_SF3B4 99..181 CDD:240781 27/81 (33%)
EEED8.12NP_495021.1 RRM <11..>133 CDD:223796 37/115 (32%)
RRM_II_PABPs 62..134 CDD:240752 25/73 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D491103at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.