DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spx and rbm11

DIOPT Version :9

Sequence 1:NP_511058.1 Gene:Spx / 31558 FlyBaseID:FBgn0015818 Length:347 Species:Drosophila melanogaster
Sequence 2:NP_001373296.1 Gene:rbm11 / 100526814 ZFINID:ZDB-GENE-091204-317 Length:212 Species:Danio rerio


Alignment Length:88 Identity:33/88 - (37%)
Similarity:47/88 - (53%) Gaps:4/88 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 TIYAGGLDDKVSETLLWELFVQAGPVVNVHMPKDRVTQMHQGYGFVEFLSEEDADYGIKIMNMIK 78
            ||..|.|...|:|.:|:|||:|||||..||:.:|   .....|..|.:...|...|.::::|.|.
Zfish    11 TIIVGNLHRCVTEEILFELFLQAGPVDKVHISRD---GQQSPYACVYYKHAEAVPYAVELLNGIW 72

  Fly    79 LYGKPIRVN-KASAHQKNLDVGA 100
            |||:||::. ....|....||.|
Zfish    73 LYGQPIKLQCNNGGHYHRSDVFA 95

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SpxNP_511058.1 RRM1_SF3B4 15..88 CDD:240780 28/73 (38%)
RRM2_SF3B4 99..181 CDD:240781 1/2 (50%)
rbm11NP_001373296.1 RRM_SF 9..81 CDD:418427 29/72 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D491103at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.