DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Kirrel3 and DIP-delta

DIOPT Version :9

Sequence 1:XP_038937320.1 Gene:Kirrel3 / 315546 RGDID:1311382 Length:869 Species:Rattus norvegicus
Sequence 2:NP_001097508.2 Gene:DIP-delta / 5740816 FlyBaseID:FBgn0085420 Length:469 Species:Drosophila melanogaster


Alignment Length:445 Identity:99/445 - (22%)
Similarity:165/445 - (37%) Gaps:82/445 - (18%)


- Green bases have known domain annotations that are detailed below.


  Rat    50 FSQQPQDQVVVSGQPVTLLCAIPEYDGF-VLW--IKDGLALGVGRD-LSSYPQYLVVGNHLSGEH 110
            |:|...:..|..|:...|.|.:....|: |.|  |...:.|.:.|. :|..|:|.:  .:.....
  Fly    46 FAQPIPNVTVAVGRDANLPCVVEHLGGYKVAWIHIDRQMILTIHRHVISRIPRYSI--TYTDNTW 108

  Rat   111 HLKILRAELQDDAVYECQAIQAAIRSRPARLTVLVPPDDPIILGGP-VISLRAGDPLNLTCHADN 174
            .|.:.:|...|...|.||.....:.|:...|.|:|||:...|...| .:::|....:|:||.||.
  Fly   109 LLHVNQAHQDDRGYYMCQVNTNPMISQVGYLQVVVPPNILDIESTPSSVAVRENQNINMTCRADG 173

  Rat   175 AKPAASIIWLRK-GEVINGATYSKTLLRDGKRESIVSTLFISPGDVENGQSIVCRATNKAIPGGK 238
            . ||..|||.|: ||.|......|.|:.|.   .::....:|..::   .:.:|.||| .:|...
  Fly   174 F-PAPKIIWRREDGEEIAVEKKKKVLVYDA---DVLPLTKVSRNEM---GAYLCIATN-GVPPSV 230

  Rat   239 ETSVTIDIQHPPLVNLSVEPQPVLEDNIVTFHCSAKANPAVTQYRWAKRGHIIKEASGELYRTTV 303
            ...:.:|::..|::.:..:.........||..|..:|:|....| |.....::  ...:.|:|  
  Fly   231 SKRIILDVEFSPMIWVPNQLVGAPSGTDVTIDCHTEAHPKAIIY-WVYNSVMV--LPSKKYKT-- 290

  Rat   304 DYTYFSEPVSCEVT-----------------NALGSTNLSRTVDVYFGPRMTSEPQSLLVDLGSD 351
            |||..|.....::|                 |:||.|.                        ||.
  Fly   291 DYTENSYRAHMKLTIRNLQYGDFGNYRCISKNSLGETE------------------------GSI 331

  Rat   352 AVFSCAWIGNPS--LTIVWMKRGSGVVLSNEKTLTLKSVRQEDAGKYVCRAVVPRVGAGEREVTL 414
            .|:.......||  :|...::.....::.:.:..|.||: |.|.|..:...:.|  |:.....:.
  Fly   332 RVYEIPLPSTPSKQVTHTTVESRENNIIPSSRNDTTKSL-QTDVGYAMKNDLYP--GSASSSSSG 393

  Rat   415 TVNGPPIISSTQTQHAL-----------HGEKGQI----KCFIRSTPPPDRIAWS 454
            ..:.....||:....||           .|.||.:    ..|....||.:..|.|
  Fly   394 GSSSAASSSSSMQTSALPGGVAGNSLSSMGSKGSLAIGKSTFYTERPPNEYAASS 448

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Kirrel3XP_038937320.1 IG_like 54..143 CDD:214653 21/92 (23%)
Ig strand A' 56..60 CDD:409353 0/3 (0%)
Ig strand B 64..71 CDD:409353 2/6 (33%)
Ig strand C 78..82 CDD:409353 2/5 (40%)
Ig strand C' 84..87 CDD:409353 0/2 (0%)
Ig strand D 97..101 CDD:409353 2/3 (67%)
Ig strand E 104..116 CDD:409353 1/11 (9%)
Ig strand G 132..143 CDD:409353 2/10 (20%)
IgI_2_KIRREL3-like 149..246 CDD:409416 26/98 (27%)
Ig strand B 166..170 CDD:409416 1/3 (33%)
Ig strand C 180..184 CDD:409416 2/3 (67%)
Ig strand E 210..214 CDD:409416 0/3 (0%)
Ig strand F 224..229 CDD:409416 1/4 (25%)
Ig strand G 239..242 CDD:409416 0/2 (0%)
Ig <267..334 CDD:416386 18/83 (22%)
Ig strand B 267..274 CDD:409353 3/6 (50%)
Ig strand C 279..286 CDD:409353 2/6 (33%)
Ig strand C' 288..291 CDD:409353 0/2 (0%)
Ig strand D 298..302 CDD:409353 1/3 (33%)
Ig strand E 304..310 CDD:409353 3/5 (60%)
Ig strand G 321..334 CDD:409353 2/12 (17%)
Ig 335..416 CDD:416386 14/82 (17%)
Ig strand A' 343..347 CDD:409353 0/3 (0%)
Ig strand B 350..360 CDD:409353 2/9 (22%)
Ig strand C 365..371 CDD:409353 1/5 (20%)
Ig strand E 381..387 CDD:409353 1/5 (20%)
IgI_5_KIRREL3 418..515 CDD:409479 12/52 (23%)
Ig strand B 436..440 CDD:409479 1/7 (14%)
Ig strand C 450..454 CDD:409479 1/3 (33%)
Ig strand E 481..485 CDD:409479
Ig strand F 496..501 CDD:409479
Ig strand G 509..512 CDD:409479
DIP-deltaNP_001097508.2 IG 51..143 CDD:214652 22/93 (24%)
Ig 145..238 CDD:416386 27/100 (27%)
Ig strand A 145..149 CDD:409353 1/3 (33%)
Ig strand A' 154..159 CDD:409353 1/4 (25%)
Ig strand B 165..172 CDD:409353 3/6 (50%)
Ig strand C 178..183 CDD:409353 3/4 (75%)
Ig strand C' 185..187 CDD:409353 0/1 (0%)
Ig strand D 195..199 CDD:409353 1/3 (33%)
Ig strand E 203..209 CDD:409353 0/5 (0%)
Ig strand F 216..223 CDD:409353 1/6 (17%)
Ig strand G 230..238 CDD:409353 0/7 (0%)
Ig 242..333 CDD:416386 21/119 (18%)
Ig strand A' 250..253 CDD:409353 0/2 (0%)
Ig strand B 259..266 CDD:409353 3/6 (50%)
Ig strand C 272..277 CDD:409353 2/5 (40%)
Ig strand C' 281..283 CDD:409353 0/3 (0%)
Ig strand D 289..293 CDD:409353 2/5 (40%)
Ig strand E 295..305 CDD:409353 1/9 (11%)
Ig strand F 314..322 CDD:409353 0/7 (0%)
Ig strand G 325..334 CDD:409353 4/32 (13%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.