DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sqh and MYL10

DIOPT Version :9

Sequence 1:NP_001284928.1 Gene:sqh / 31554 FlyBaseID:FBgn0003514 Length:174 Species:Drosophila melanogaster
Sequence 2:NP_612412.2 Gene:MYL10 / 93408 HGNCID:29825 Length:226 Species:Homo sapiens


Alignment Length:203 Identity:88/203 - (43%)
Similarity:121/203 - (59%) Gaps:40/203 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 AGRRATTKKRAQ-RATSNVFAMFDQAQIAEFKE-------------------------------- 38
            |.|||  :|||: .|:||||:||||:||.||||                                
Human    27 APRRA--RKRAEGTASSNVFSMFDQSQIQEFKESLALSPRLERNGMISAHCNLCLTGSSNSPASA 89

  Fly    39 --AFNMIDQNRDGFVEKEDLHDMLASLGK-NPTDDYLDGMMNEAPGPINFTMFLTLFGERLQGTD 100
              ||.::|||||||::||||.|..|:||: |..::.|:.|:.|||||||||:|||:|||:|:|||
Human    90 SQAFTIMDQNRDGFIDKEDLRDTFAALGRINVKNEELEAMVKEAPGPINFTVFLTMFGEKLKGTD 154

  Fly   101 PEDVIKNAFGCFDEENMGVLPEDRLRELLTTMGDRFTDEDVDEMYRE-APIKNGLFDYLEFTRIL 164
            ||:.|.:||..||.|..|.:..|.::|.|.|..|||::|:|.:|:.. .|...|..||.....::
Human   155 PEETILHAFKVFDTEGKGFVKADVIKEKLMTQADRFSEEEVKQMFAAFPPDVCGNLDYRNLCYVI 219

  Fly   165 KHGAKDKD 172
            .|| ::||
Human   220 THG-EEKD 226

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
sqhNP_001284928.1 FRQ1 15..170 CDD:227455 82/191 (43%)
MYL10NP_612412.2 FRQ1 40..223 CDD:227455 78/183 (43%)
EF-hand motif 89..118 CDD:320054 16/28 (57%)
EF-hand motif 149..187 CDD:320054 17/37 (46%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 108 1.000 Domainoid score I6417
eggNOG 1 0.900 - - E2759_KOG0031
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1435392at2759
OrthoFinder 1 1.000 - - FOG0000218
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR23049
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X162
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
76.920

Return to query results.
Submit another query.