Sequence 1: | NP_001284928.1 | Gene: | sqh / 31554 | FlyBaseID: | FBgn0003514 | Length: | 174 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_612412.2 | Gene: | MYL10 / 93408 | HGNCID: | 29825 | Length: | 226 | Species: | Homo sapiens |
Alignment Length: | 203 | Identity: | 88/203 - (43%) |
---|---|---|---|
Similarity: | 121/203 - (59%) | Gaps: | 40/203 - (19%) |
- Green bases have known domain annotations that are detailed below.
Fly 7 AGRRATTKKRAQ-RATSNVFAMFDQAQIAEFKE-------------------------------- 38
Fly 39 --AFNMIDQNRDGFVEKEDLHDMLASLGK-NPTDDYLDGMMNEAPGPINFTMFLTLFGERLQGTD 100
Fly 101 PEDVIKNAFGCFDEENMGVLPEDRLRELLTTMGDRFTDEDVDEMYRE-APIKNGLFDYLEFTRIL 164
Fly 165 KHGAKDKD 172 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
sqh | NP_001284928.1 | FRQ1 | 15..170 | CDD:227455 | 82/191 (43%) |
MYL10 | NP_612412.2 | FRQ1 | 40..223 | CDD:227455 | 78/183 (43%) |
EF-hand motif | 89..118 | CDD:320054 | 16/28 (57%) | ||
EF-hand motif | 149..187 | CDD:320054 | 17/37 (46%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 1 | 1.000 | 108 | 1.000 | Domainoid score | I6417 |
eggNOG | 1 | 0.900 | - | - | E2759_KOG0031 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 1 | 1.010 | - | - | D1435392at2759 | |
OrthoFinder | 1 | 1.000 | - | - | FOG0000218 | |
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 1 | 1.100 | - | - | O | PTHR23049 |
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 1 | 1.000 | - | - | X162 | |
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
7 | 6.920 |