DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sqh and CAM9

DIOPT Version :9

Sequence 1:NP_001284928.1 Gene:sqh / 31554 FlyBaseID:FBgn0003514 Length:174 Species:Drosophila melanogaster
Sequence 2:NP_190760.1 Gene:CAM9 / 824355 AraportID:AT3G51920 Length:151 Species:Arabidopsis thaliana


Alignment Length:142 Identity:47/142 - (33%)
Similarity:75/142 - (52%) Gaps:5/142 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 FDQAQIAEFKEAFNMIDQNRDGFVEKEDLHDMLASLGKNPTDDYLDGMMNEAP----GPINFTMF 88
            |...||.||.|||.:||::.|||:.||.|..::.|:||||..:.|..||::..    |.|.|..|
plant     5 FTDEQIQEFYEAFCLIDKDSDGFITKEKLTKVMKSMGKNPKAEQLQQMMSDVDIFGNGGITFDDF 69

  Fly    89 LTLFGERLQGTDPEDVIKNAFGCFDEENMGVLPEDRLRELLTTMGDRFTDEDVDEMYREAPIK-N 152
            |.:..:........|.:...|..||.:..|::.:..|.|.:..||.:.|.|:.:.|.|||.:. :
plant    70 LYIMAQNTSQESASDELIEVFRVFDRDGDGLISQLELGEGMKDMGMKITAEEAEHMVREADLDGD 134

  Fly   153 GLFDYLEFTRIL 164
            |...:.||::::
plant   135 GFLSFHEFSKMM 146

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
sqhNP_001284928.1 FRQ1 15..170 CDD:227455 47/142 (33%)
CAM9NP_190760.1 PTZ00184 1..148 CDD:185504 47/142 (33%)
EFh 12..74 CDD:238008 26/61 (43%)
EFh 85..146 CDD:238008 17/60 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1435392at2759
OrthoFinder 1 1.000 - - FOG0000218
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.