DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sqh and AT3G03000

DIOPT Version :9

Sequence 1:NP_001284928.1 Gene:sqh / 31554 FlyBaseID:FBgn0003514 Length:174 Species:Drosophila melanogaster
Sequence 2:NP_186950.1 Gene:AT3G03000 / 821161 AraportID:AT3G03000 Length:165 Species:Arabidopsis thaliana


Alignment Length:158 Identity:45/158 - (28%)
Similarity:73/158 - (46%) Gaps:20/158 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 AMFDQAQIAEFKEAFNMIDQNRDGFVEKEDLHDMLASLGKNPTDDYLDGMMNEAP----GPINFT 86
            |.....|:||.:|.|...|||:||.:.:.:|..:|.|||..|:.|.||.::.:|.    |.:.|:
plant    11 AKLGDEQLAELREIFRSFDQNKDGSLTELELGSLLRSLGLKPSQDQLDTLIQKADRNNNGLVEFS 75

  Fly    87 MFLTLFGERLQGTDP--------EDVIKNAFGCFDEENMGVLPEDRLRELLTTMGDRFTDEDVDE 143
            .|:.|       .:|        :|.:|..|..||.:..|.:....|...:..:|...|.|::..
plant    76 EFVAL-------VEPDLVKCPYTDDQLKAIFRMFDRDGNGYITAAELAHSMAKLGHALTAEELTG 133

  Fly   144 MYREAPIK-NGLFDYLEFTRILKHGAKD 170
            |.:||... :|..|:.||.:.:...|.|
plant   134 MIKEADRDGDGCIDFQEFVQAITSAAFD 161

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
sqhNP_001284928.1 FRQ1 15..170 CDD:227455 44/156 (28%)
AT3G03000NP_186950.1 PTZ00184 10..157 CDD:185504 43/152 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1435392at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.