DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sqh and AT3G10190

DIOPT Version :9

Sequence 1:NP_001284928.1 Gene:sqh / 31554 FlyBaseID:FBgn0003514 Length:174 Species:Drosophila melanogaster
Sequence 2:NP_187630.1 Gene:AT3G10190 / 820181 AraportID:AT3G10190 Length:209 Species:Arabidopsis thaliana


Alignment Length:136 Identity:40/136 - (29%)
Similarity:70/136 - (51%) Gaps:6/136 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    35 EFKEAFNMIDQNRDGFVEKEDLHDMLASLGKNP-TDDYLDGMMNEAPGPINFTMFLTLFGERLQG 98
            |..:||.:||::.||.|.:.||..:|:.||.:| |::.::.|:.|.....:.|:.|.....|:..
plant    70 EILQAFKLIDRDNDGAVSRHDLESLLSRLGPDPLTEEEINVMLKEVDCDGDGTIRLEELASRVVS 134

  Fly    99 TDP---EDVIKNAFGCFDEENMGVLPEDRLRELLTTMGD-RFTDEDVDEMYREAPIK-NGLFDYL 158
            .||   ...:|..|..||.:..|::..|.|..:.:|:|| |.|.:|...|..:.... :|...:.
plant   135 LDPARDSTELKETFEFFDADRDGLISADELLRVFSTIGDERCTLDDCKRMIADVDEDGDGFVCFT 199

  Fly   159 EFTRIL 164
            ||:|::
plant   200 EFSRMM 205

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
sqhNP_001284928.1 FRQ1 15..170 CDD:227455 40/136 (29%)
AT3G10190NP_187630.1 EFh 70..132 CDD:238008 19/61 (31%)
EF-hand_7 71..129 CDD:290234 18/57 (32%)
EFh 143..205 CDD:238008 18/61 (30%)
EF-hand_7 144..205 CDD:290234 18/60 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1435392at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.