DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sqh and CALML3

DIOPT Version :10

Sequence 1:NP_511057.1 Gene:sqh / 31554 FlyBaseID:FBgn0003514 Length:174 Species:Drosophila melanogaster
Sequence 2:NP_005176.1 Gene:CALML3 / 810 HGNCID:1452 Length:149 Species:Homo sapiens


Alignment Length:41 Identity:11/41 - (26%)
Similarity:16/41 - (39%) Gaps:6/41 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 PSQQRPLTYRWFPSWRFMTSIMLCFCFGCVHLMNSNMGMAI 64
            ||:.:. .|.|.......|.|.|     |::.....|.||:
Human     5 PSRMQQ-NYDWQCEDAINTHIQL-----CLYASYEYMSMAV 39

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
sqhNP_511057.1 PTZ00184 27..164 CDD:185504 9/38 (24%)
CALML3NP_005176.1 PTZ00184 1..149 CDD:185504 11/41 (27%)

Return to query results.
Submit another query.