DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sqh and myl2b

DIOPT Version :9

Sequence 1:NP_001284928.1 Gene:sqh / 31554 FlyBaseID:FBgn0003514 Length:174 Species:Drosophila melanogaster
Sequence 2:NP_001035134.1 Gene:myl2b / 677750 ZFINID:ZDB-GENE-060331-137 Length:168 Species:Danio rerio


Alignment Length:163 Identity:86/163 - (52%)
Similarity:115/163 - (70%) Gaps:3/163 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 KKRAQRATSNVFAMFDQAQIAEFKEAFNMIDQNRDGFVEKEDLHDMLASLGK-NPTDDYLDGMMN 77
            ||||:.|.||||:||:||||.||||||.::|||||||::|.||.|..|:||: |...:.||.|:.
Zfish     7 KKRAEGANSNVFSMFEQAQIQEFKEAFTIMDQNRDGFIDKNDLRDTFAALGRLNVKQEELDEMLK 71

  Fly    78 EAPGPINFTMFLTLFGERLQGTDPEDVIKNAFGCFDEENMGVLPEDRLRELLTTMGDRFTDEDVD 142
            |||||||||:|||:|||:|:|.|.|:.|.|||..||.|..|.|.:|.|..:|||..|||:.|:::
Zfish    72 EAPGPINFTVFLTMFGEKLKGADAEETILNAFKVFDPEGKGTLRKDFLSRMLTTQADRFSPEEME 136

  Fly   143 EMYRE-APIKNGLFDYLEFTRILKHGAKDKDEQ 174
            :|:.. .|...|..||.....|:.|| ::||::
Zfish   137 QMFSAFPPDAAGNLDYKNLVYIITHG-EEKDQE 168

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
sqhNP_001284928.1 FRQ1 15..170 CDD:227455 83/156 (53%)
myl2bNP_001035134.1 FRQ1 15..163 CDD:227455 79/148 (53%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 102 1.000 Domainoid score I6778
eggNOG 1 0.900 - - E2759_KOG0031
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1435392at2759
OrthoFinder 1 1.000 - - FOG0000218
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR23049
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X162
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
76.920

Return to query results.
Submit another query.