DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sqh and Myl12a

DIOPT Version :9

Sequence 1:NP_001284928.1 Gene:sqh / 31554 FlyBaseID:FBgn0003514 Length:174 Species:Drosophila melanogaster
Sequence 2:NP_001344749.1 Gene:Myl12a / 67268 MGIID:1914518 Length:178 Species:Mus musculus


Alignment Length:174 Identity:139/174 - (79%)
Similarity:157/174 - (90%) Gaps:3/174 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSSRKTAGRRATTKKRAQRATSNVFAMFDQAQIAEFKEAFNMIDQNRDGFVEKEDLHDMLASLGK 65
            |||::  .:..|||||.|||||||||||||:||.||||||||||||||||::||||||||||:||
Mouse     7 MSSKR--AKTKTTKKRPQRATSNVFAMFDQSQIQEFKEAFNMIDQNRDGFIDKEDLHDMLASMGK 69

  Fly    66 NPTDDYLDGMMNEAPGPINFTMFLTLFGERLQGTDPEDVIKNAFGCFDEENMGVLPEDRLRELLT 130
            ||||:|||.||||||||||||||||:|||:|.||||||||:|||.|||||.:|.:.||.||||||
Mouse    70 NPTDEYLDAMMNEAPGPINFTMFLTMFGEKLNGTDPEDVIRNAFACFDEEAIGTIQEDYLRELLT 134

  Fly   131 TMGDRFTDEDVDEMYREAPI-KNGLFDYLEFTRILKHGAKDKDE 173
            |||||||||:|||:|||||| |.|.|:|:||||||||||||||:
Mouse   135 TMGDRFTDEEVDELYREAPIDKKGNFNYIEFTRILKHGAKDKDD 178

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
sqhNP_001284928.1 FRQ1 15..170 CDD:227455 129/155 (83%)
Myl12aNP_001344749.1 FRQ1 25..175 CDD:227455 124/149 (83%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0031
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 - - H68515
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1435392at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_103056
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R4770
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
65.800

Return to query results.
Submit another query.