DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sqh and Myl10

DIOPT Version :9

Sequence 1:NP_001284928.1 Gene:sqh / 31554 FlyBaseID:FBgn0003514 Length:174 Species:Drosophila melanogaster
Sequence 2:XP_017176539.1 Gene:Myl10 / 59310 MGIID:1891705 Length:232 Species:Mus musculus


Alignment Length:139 Identity:75/139 - (53%)
Similarity:103/139 - (74%) Gaps:1/139 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 SRKTAGRRATTKKRAQRATSNVFAMFDQAQIAEFKEAFNMIDQNRDGFVEKEDLHDMLASLGK-N 66
            :|:|...|...|:....|:||||:||||:||.||||||.::|||||||::||||.|..|:||: |
Mouse    26 ARQTMAPRRARKRVEGTASSNVFSMFDQSQIQEFKEAFTIMDQNRDGFIDKEDLRDTFAALGRIN 90

  Fly    67 PTDDYLDGMMNEAPGPINFTMFLTLFGERLQGTDPEDVIKNAFGCFDEENMGVLPEDRLRELLTT 131
            ..::.|:.|:.|||||||||:|||:|||:|:|||||:.|.:||..||.|..|.:..|.::|.|.|
Mouse    91 VKNEELEAMVKEAPGPINFTVFLTMFGEKLKGTDPEETILHAFKVFDTEGKGFVKADFIKEKLMT 155

  Fly   132 MGDRFTDED 140
            ..|||::|:
Mouse   156 QADRFSEEE 164

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
sqhNP_001284928.1 FRQ1 15..170 CDD:227455 71/127 (56%)
Myl10XP_017176539.1 FRQ1 44..164 CDD:227455 69/119 (58%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 106 1.000 Domainoid score I6572
eggNOG 1 0.900 - - E2759_KOG0031
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000218
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR23049
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X162
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
65.910

Return to query results.
Submit another query.