DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sqh and MYL7

DIOPT Version :9

Sequence 1:NP_001284928.1 Gene:sqh / 31554 FlyBaseID:FBgn0003514 Length:174 Species:Drosophila melanogaster
Sequence 2:XP_011513765.1 Gene:MYL7 / 58498 HGNCID:21719 Length:231 Species:Homo sapiens


Alignment Length:233 Identity:88/233 - (37%)
Similarity:120/233 - (51%) Gaps:62/233 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSSRK--TAGRRATTKKRAQRATSNVFAMFDQAQIAEFKE-----------------------AF 40
            |:|||  |.|:.|.| |:|||.:||||:||:||||.||||                       ||
Human     1 MASRKAGTRGKVAAT-KQAQRGSSNVFSMFEQAQIQEFKEVSPPPPTFPRAGGCSHLKAPIPQAF 64

  Fly    41 NMIDQNRDGFVEKEDLHDMLASLGK-NPTDDYLDGMMNEAPGPINFTMFLTLFGERLQGTDPEDV 104
            :.|||||||.:.|.||.:..:.||| :..::.||.|:.|..||||||:|||||||:|.|||||:.
Human    65 SCIDQNRDGIICKADLRETYSQLGKVSVPEEELDAMLQEGKGPINFTVFLTLFGEKLNGTDPEEA 129

  Fly   105 IKNAFGCFDEENMGVLPEDRLRELLTTMGDRFTDED----------------------------- 140
            |.:||..||....||:.:|..::||.|..|:|:..:                             
Human   130 ILSAFRMFDPSGKGVVNKDEFKQLLLTQADKFSPAEVRLPSPFNTHPQHLLWAFTHDPEPSTSEA 194

  Fly   141 ----VDEMYREAPIK-NGLFDYLEFTRILKHGAKDKDE 173
                |::|:...|:. .|..||.....|:.|| .:|:|
Human   195 VAGRVEQMFALTPMDLAGNIDYKSLCYIITHG-DEKEE 231

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
sqhNP_001284928.1 FRQ1 15..170 CDD:227455 78/212 (37%)
MYL7XP_011513765.1 EF-hand_7 62..154 CDD:290234 46/91 (51%)
EF-hand_8 72..157 CDD:290545 41/84 (49%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0031
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1435392at2759
OrthoFinder 1 1.000 - - FOG0000218
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR23049
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X162
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
65.920

Return to query results.
Submit another query.