Sequence 1: | NP_001284928.1 | Gene: | sqh / 31554 | FlyBaseID: | FBgn0003514 | Length: | 174 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | XP_011513765.1 | Gene: | MYL7 / 58498 | HGNCID: | 21719 | Length: | 231 | Species: | Homo sapiens |
Alignment Length: | 233 | Identity: | 88/233 - (37%) |
---|---|---|---|
Similarity: | 120/233 - (51%) | Gaps: | 62/233 - (26%) |
- Green bases have known domain annotations that are detailed below.
Fly 1 MSSRK--TAGRRATTKKRAQRATSNVFAMFDQAQIAEFKE-----------------------AF 40
Fly 41 NMIDQNRDGFVEKEDLHDMLASLGK-NPTDDYLDGMMNEAPGPINFTMFLTLFGERLQGTDPEDV 104
Fly 105 IKNAFGCFDEENMGVLPEDRLRELLTTMGDRFTDED----------------------------- 140
Fly 141 ----VDEMYREAPIK-NGLFDYLEFTRILKHGAKDKDE 173 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
sqh | NP_001284928.1 | FRQ1 | 15..170 | CDD:227455 | 78/212 (37%) |
MYL7 | XP_011513765.1 | EF-hand_7 | 62..154 | CDD:290234 | 46/91 (51%) |
EF-hand_8 | 72..157 | CDD:290545 | 41/84 (49%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E2759_KOG0031 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 1 | 1.010 | - | - | D1435392at2759 | |
OrthoFinder | 1 | 1.000 | - | - | FOG0000218 | |
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 1 | 1.100 | - | - | O | PTHR23049 |
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 1 | 1.000 | - | - | X162 | |
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
6 | 5.920 |