powered by:
Protein Alignment sqh and ocm4.4
DIOPT Version :9
Sequence 1: | NP_001284928.1 |
Gene: | sqh / 31554 |
FlyBaseID: | FBgn0003514 |
Length: | 174 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_001015897.1 |
Gene: | ocm4.4 / 548651 |
XenbaseID: | XB-GENE-5936750 |
Length: | 109 |
Species: | Xenopus tropicalis |
Alignment Length: | 52 |
Identity: | 17/52 - (32%) |
Similarity: | 25/52 - (48%) |
Gaps: | 3/52 - (5%) |
- Green bases have known domain annotations that are detailed below.
Fly 78 EAPGPINFTMFLTLFGERLQGTDPEDVIKNAFGCFDEENMGVLPEDRLRELL 129
:||...|:..|....| |.....:|| :|||...|::..|.:.||.|:..|
Frog 20 QAPDSFNYKSFFAQSG--LSSKSVDDV-RNAFAILDQDKSGFIEEDELKLFL 68
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
1 |
1.010 |
- |
- |
|
D1435392at2759 |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
1 | 1.010 |
|
Return to query results.
Submit another query.