DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sqh and ocm4.4

DIOPT Version :9

Sequence 1:NP_001284928.1 Gene:sqh / 31554 FlyBaseID:FBgn0003514 Length:174 Species:Drosophila melanogaster
Sequence 2:NP_001015897.1 Gene:ocm4.4 / 548651 XenbaseID:XB-GENE-5936750 Length:109 Species:Xenopus tropicalis


Alignment Length:52 Identity:17/52 - (32%)
Similarity:25/52 - (48%) Gaps:3/52 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    78 EAPGPINFTMFLTLFGERLQGTDPEDVIKNAFGCFDEENMGVLPEDRLRELL 129
            :||...|:..|....|  |.....:|| :|||...|::..|.:.||.|:..|
 Frog    20 QAPDSFNYKSFFAQSG--LSSKSVDDV-RNAFAILDQDKSGFIEEDELKLFL 68

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
sqhNP_001284928.1 FRQ1 15..170 CDD:227455 17/52 (33%)
ocm4.4NP_001015897.1 EFh_parvalbumin_beta 10..109 CDD:319998 17/52 (33%)
EF-hand motif 10..38 CDD:319998 6/19 (32%)
EF-hand motif 43..72 CDD:319998 11/27 (41%)
EF-hand motif 82..109 CDD:319998
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1435392at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.