DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sqh and mylpfb

DIOPT Version :9

Sequence 1:NP_001284928.1 Gene:sqh / 31554 FlyBaseID:FBgn0003514 Length:174 Species:Drosophila melanogaster
Sequence 2:NP_001004668.1 Gene:mylpfb / 447930 ZFINID:ZDB-GENE-040912-115 Length:170 Species:Danio rerio


Alignment Length:169 Identity:79/169 - (46%)
Similarity:118/169 - (69%) Gaps:2/169 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 AGRRATTKKRAQRATSNVFAMFDQAQIAEFKEAFNMIDQNRDGFVEKEDLHDMLASLGK-NPTDD 70
            |.::|..:::|:..:||||:||:|:||.|:||||.:|||||||.:.|:||.|:||::|: |..::
Zfish     2 APKKAKKRQQAEGGSSNVFSMFEQSQIQEYKEAFTIIDQNRDGIISKDDLRDVLATMGQLNVKNE 66

  Fly    71 YLDGMMNEAPGPINFTMFLTLFGERLQGTDPEDVIKNAFGCFDEENMGVLPEDRLRELLTTMGDR 135
            .|:.|:.||.||||||:|||:|||:|:|.||||||.:||...|.|..|.:.::.|.|||||..||
Zfish    67 ELEAMVKEASGPINFTVFLTMFGEKLKGADPEDVIVSAFKVLDPEATGTIKKEFLEELLTTQCDR 131

  Fly   136 FTDEDVDEMYRE-APIKNGLFDYLEFTRILKHGAKDKDE 173
            ||.|::..::.. .|...|..||.....::.||.:.::|
Zfish   132 FTAEEMKNLWAAFPPDVAGNVDYKNICYVITHGEEKEEE 170

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
sqhNP_001284928.1 FRQ1 15..170 CDD:227455 76/156 (49%)
mylpfbNP_001004668.1 FRQ1 16..165 CDD:227455 74/148 (50%)
EFh 30..88 CDD:238008 33/57 (58%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 102 1.000 Domainoid score I6778
eggNOG 1 0.900 - - E2759_KOG0031
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1435392at2759
OrthoFinder 1 1.000 - - FOG0000218
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR23049
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X162
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
76.920

Return to query results.
Submit another query.