DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sqh and CG13526

DIOPT Version :9

Sequence 1:NP_001284928.1 Gene:sqh / 31554 FlyBaseID:FBgn0003514 Length:174 Species:Drosophila melanogaster
Sequence 2:NP_611714.1 Gene:CG13526 / 37613 FlyBaseID:FBgn0034774 Length:154 Species:Drosophila melanogaster


Alignment Length:136 Identity:25/136 - (18%)
Similarity:59/136 - (43%) Gaps:8/136 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    33 IAEFKEAFNMIDQNRDGFVEKEDLHDMLASLGKNPTD----DYLDGMMNEAPGPINFTMFLTLFG 93
            |.|.::||...|.:.:|.:...::...|.|:|...|:    |.:..:.......::...|:.:..
  Fly    14 IDELRDAFEKYDLDSNGTLSANEVRLALISVGYEITEAELYDLIHSVAVRDEERLDLKKFIRMMA 78

  Fly    94 ERLQGTDPEDVIKNAFGCFDEENMGVLPEDRLRELLTTMGDRFTDEDVDEMYREAPI----KNGL 154
            .|:...|.:..:...|...|.:..|.:....:|.::..:|:..||:|:.::.:...:    :..|
  Fly    79 PRMANVDSDKSLCRTFNMIDRDRDGYVTVQDVRAIMVVLGEVVTDDDIKDICQAVDMDGDGRISL 143

  Fly   155 FDYLEF 160
            .|::.|
  Fly   144 RDFVGF 149

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
sqhNP_001284928.1 FRQ1 15..170 CDD:227455 25/136 (18%)
CG13526NP_611714.1 PTZ00184 7..152 CDD:185504 25/136 (18%)
EFh 16..78 CDD:238008 11/61 (18%)
EFh 92..151 CDD:238008 11/58 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1435392at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.