DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sqh and Myl2

DIOPT Version :9

Sequence 1:NP_001284928.1 Gene:sqh / 31554 FlyBaseID:FBgn0003514 Length:174 Species:Drosophila melanogaster
Sequence 2:NP_001030329.2 Gene:Myl2 / 363925 RGDID:1564245 Length:166 Species:Rattus norvegicus


Alignment Length:174 Identity:87/174 - (50%)
Similarity:118/174 - (67%) Gaps:10/174 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSSRKTAGRRATTKKRAQRATSNVFAMFDQAQIAEFKEAFNMIDQNRDGFVEKEDLHDMLASLGK 65
            ||.:|       .|||.:..:||||:||:|.||.||||||.::|||||||::|.||.|..|:||:
  Rat     1 MSPKK-------AKKRLEGGSSNVFSMFEQTQIQEFKEAFTIMDQNRDGFIDKNDLRDTFAALGR 58

  Fly    66 -NPTDDYLDGMMNEAPGPINFTMFLTLFGERLQGTDPEDVIKNAFGCFDEENMGVLPEDRLRELL 129
             |..::.:|.|:.|||||||||:|||:|||:|:|.|||:.|.|||..||.|..|.|..|.:||:|
  Rat    59 VNVKNEEIDEMIKEAPGPINFTVFLTMFGEKLKGADPEETILNAFKVFDPEGKGSLKADYVREML 123

  Fly   130 TTMGDRFTDEDVDEMYRE-APIKNGLFDYLEFTRILKHGAKDKD 172
            ||..:||:.|::|:|:.. .|...|..||.....|:.|| ::||
  Rat   124 TTQAERFSKEEIDQMFAAFPPDVTGNLDYKNLVHIITHG-EEKD 166

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
sqhNP_001284928.1 FRQ1 15..170 CDD:227455 81/156 (52%)
Myl2NP_001030329.2 FRQ1 14..163 CDD:227455 79/149 (53%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1435392at2759
OrthoFinder 1 1.000 - - FOG0000218
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR23049
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X162
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
66.020

Return to query results.
Submit another query.