DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sqh and myl12.1

DIOPT Version :9

Sequence 1:NP_001284928.1 Gene:sqh / 31554 FlyBaseID:FBgn0003514 Length:174 Species:Drosophila melanogaster
Sequence 2:NP_999864.1 Gene:myl12.1 / 326719 ZFINID:ZDB-GENE-030131-4918 Length:172 Species:Danio rerio


Alignment Length:174 Identity:135/174 - (77%)
Similarity:153/174 - (87%) Gaps:3/174 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSSRKTAGRRATTKKRAQRATSNVFAMFDQAQIAEFKEAFNMIDQNRDGFVEKEDLHDMLASLGK 65
            |||::..|:  .||||.|||||||||||||:||.||||||||||||||||::|||||||||||||
Zfish     1 MSSKRAKGK--ITKKRPQRATSNVFAMFDQSQIQEFKEAFNMIDQNRDGFIDKEDLHDMLASLGK 63

  Fly    66 NPTDDYLDGMMNEAPGPINFTMFLTLFGERLQGTDPEDVIKNAFGCFDEENMGVLPEDRLRELLT 130
            ||.||||:.||.|||||||||||||:|||:|.|||||:||:|||.|||||..|.:.||.||||||
Zfish    64 NPADDYLEAMMTEAPGPINFTMFLTMFGEKLNGTDPEEVIRNAFACFDEEGTGFIHEDYLRELLT 128

  Fly   131 TMGDRFTDEDVDEMYREAPI-KNGLFDYLEFTRILKHGAKDKDE 173
            |||||||||:|||::||||| |...|:|:||||||||||||||:
Zfish   129 TMGDRFTDEEVDELFREAPIDKKSNFNYVEFTRILKHGAKDKDD 172

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
sqhNP_001284928.1 FRQ1 15..170 CDD:227455 125/155 (81%)
myl12.1NP_999864.1 FRQ1 19..169 CDD:227455 120/149 (81%)
EFh 33..>77 CDD:238008 37/43 (86%)
EFh 103..164 CDD:298682 43/60 (72%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170592105
Domainoid 1 1.000 63 1.000 Domainoid score I10226
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 288 1.000 Inparanoid score I2809
OMA 1 1.010 - - QHG51980
OrthoDB 1 1.010 - - D1435392at2759
OrthoFinder 1 1.000 - - FOG0000218
OrthoInspector 1 1.000 - - otm25265
orthoMCL 1 0.900 - - OOG6_103056
Panther 1 1.100 - - O PTHR23049
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X162
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
1211.910

Return to query results.
Submit another query.