DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sqh and CG33098

DIOPT Version :9

Sequence 1:NP_001284928.1 Gene:sqh / 31554 FlyBaseID:FBgn0003514 Length:174 Species:Drosophila melanogaster
Sequence 2:NP_001262501.1 Gene:CG33098 / 326253 FlyBaseID:FBgn0053098 Length:230 Species:Drosophila melanogaster


Alignment Length:169 Identity:57/169 - (33%)
Similarity:84/169 - (49%) Gaps:8/169 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 TKKRAQRATSNVFA-MFDQAQIAEFKEAFNMIDQNRDGFVEKEDLHDMLASLGKNPTDDYLDGMM 76
            |.....||..||.. ..|.|::||.||.|::.|.:.||.:.|:||.....:||..|.:..|:.||
  Fly    62 TLPEEMRADDNVAPHELDIAKLAELKEVFSLFDTDCDGLISKDDLRFTYTALGNEPNEQLLEQMM 126

  Fly    77 NEAPGPINFTMFLTLFGERLQGTDPEDVIKNAFGCFDEENMGVLPEDRLRELLTTMGDRFTDEDV 141
            .||..|:::..|:.|...|.|..|||||:..|:..:|:...|.:.|.::.|.||..||:.|..:.
  Fly   127 QEAKEPLDYEAFVRLMSRRTQELDPEDVLLEAWSKWDDHGTGKIDERKIYEELTNYGDKMTLNEA 191

  Fly   142 DEMYREAPI-------KNGLFDYLEFTRILKHGAKDKDE 173
            .|....||:       :..:.||..|.|:|....|.|.|
  Fly   192 KEALSHAPMAKPKSLEEPPMIDYPAFCRMLSGMRKRKGE 230

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
sqhNP_001284928.1 FRQ1 15..170 CDD:227455 53/162 (33%)
CG33098NP_001262501.1 FRQ1 76..195 CDD:227455 42/118 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0031
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR23049
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.