DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sqh and myl7

DIOPT Version :9

Sequence 1:NP_001284928.1 Gene:sqh / 31554 FlyBaseID:FBgn0003514 Length:174 Species:Drosophila melanogaster
Sequence 2:NP_571404.1 Gene:myl7 / 30592 ZFINID:ZDB-GENE-991019-3 Length:172 Species:Danio rerio


Alignment Length:175 Identity:90/175 - (51%)
Similarity:116/175 - (66%) Gaps:6/175 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSSRKTAGRRATTKKRAQRATSNVFAMFDQAQIAEFKEAFNMIDQNRDGFVEKEDLHDMLASLGK 65
            |:|:|.|.:|.   |.|||.:||||:||:|:||.||||||..|||||||.:.|.||.:..|.|||
Zfish     1 MASKKAAAKRG---KTAQRGSSNVFSMFEQSQIQEFKEAFGCIDQNRDGVINKSDLKETYAQLGK 62

  Fly    66 -NPTDDYLDGMMNEAPGPINFTMFLTLFGERLQGTDPEDVIKNAFGCFDEENMGVLPEDRLRELL 129
             |.:|:.|:.|:.|..||||||:|||||||:|.|||||:.|..||..||....||:.:|..:.||
Zfish    63 LNVSDEELESMLTEGKGPINFTVFLTLFGEKLNGTDPEETILAAFKLFDPNATGVVNKDEFKRLL 127

  Fly   130 TTMGDRFTDEDVDEMYREAPIK-NGLFDYLEFTRILKHGAKDKDE 173
            .|..|:||.|:||:.:..|||. .|..||.....|:.|| .:|:|
Zfish   128 MTQADKFTAEEVDQAFAVAPIDVAGNIDYKSLCYIITHG-DEKEE 171

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
sqhNP_001284928.1 FRQ1 15..170 CDD:227455 83/156 (53%)
myl7NP_571404.1 FRQ1 18..165 CDD:227455 77/146 (53%)
EFh 32..128 CDD:298682 53/95 (56%)
EFh 103..164 CDD:298682 24/60 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0031
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1435392at2759
OrthoFinder 1 1.000 - - FOG0000218
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR23049
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X162
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
65.920

Return to query results.
Submit another query.