DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sqh and mylpfa

DIOPT Version :9

Sequence 1:NP_001284928.1 Gene:sqh / 31554 FlyBaseID:FBgn0003514 Length:174 Species:Drosophila melanogaster
Sequence 2:NP_571263.1 Gene:mylpfa / 30429 ZFINID:ZDB-GENE-990712-15 Length:169 Species:Danio rerio


Alignment Length:171 Identity:83/171 - (48%)
Similarity:115/171 - (67%) Gaps:7/171 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 KTAGRRATTKKRAQRATSNVFAMFDQAQIAEFKEAFNMIDQNRDGFVEKEDLHDMLASLGK-NPT 68
            |.|.|||.    ....:||||:||:|:||.|:||||.:|||||||.:.|:||.|:|||:|: |..
Zfish     4 KKAKRRAA----GGEGSSNVFSMFEQSQIQEYKEAFTIIDQNRDGIISKDDLRDVLASMGQLNVK 64

  Fly    69 DDYLDGMMNEAPGPINFTMFLTLFGERLQGTDPEDVIKNAFGCFDEENMGVLPEDRLRELLTTMG 133
            ::.|:.|:.||.||||||:|||:|||:|:|.||||||.:||...|.|..|.:.::.|.|||||..
Zfish    65 NEELEAMIKEASGPINFTVFLTMFGEKLKGADPEDVIVSAFKVLDPEGTGSIKKEFLEELLTTQC 129

  Fly   134 DRFTDEDVDEMYRE-APIKNGLFDYLEFTRILKHGAKDKDE 173
            ||||.|::..::.. .|...|..||.....::.|| ::|:|
Zfish   130 DRFTAEEMKNLWAAFPPDVAGNVDYKNICYVITHG-EEKEE 169

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
sqhNP_001284928.1 FRQ1 15..170 CDD:227455 76/156 (49%)
mylpfaNP_571263.1 FRQ1 16..165 CDD:227455 76/149 (51%)
EFh 30..88 CDD:238008 34/57 (60%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 102 1.000 Domainoid score I6778
eggNOG 1 0.900 - - E2759_KOG0031
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1435392at2759
OrthoFinder 1 1.000 - - FOG0000218
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR23049
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X162
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
87.920

Return to query results.
Submit another query.