DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sqh and Myl7

DIOPT Version :9

Sequence 1:NP_001284928.1 Gene:sqh / 31554 FlyBaseID:FBgn0003514 Length:174 Species:Drosophila melanogaster
Sequence 2:XP_006251278.1 Gene:Myl7 / 289759 RGDID:1308262 Length:175 Species:Rattus norvegicus


Alignment Length:177 Identity:85/177 - (48%)
Similarity:120/177 - (67%) Gaps:6/177 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSSRK--TAGRRATTKKRAQRATSNVFAMFDQAQIAEFKEAFNMIDQNRDGFVEKEDLHDMLASL 63
            |:|||  |.|:.|.| |:|||.:||||:||:||||.||||||:.|||||||.:.|.||.:..:.|
  Rat     1 MASRKAGTRGKAAAT-KQAQRGSSNVFSMFEQAQIQEFKEAFSCIDQNRDGIICKSDLKETYSQL 64

  Fly    64 GK-NPTDDYLDGMMNEAPGPINFTMFLTLFGERLQGTDPEDVIKNAFGCFDEENMGVLPEDRLRE 127
            |: :..::.||.|:.|..||||||:|||||||:|.|||||:.|.:||..||....||:.::..::
  Rat    65 GRVSVPEEELDAMLQEGKGPINFTVFLTLFGEKLNGTDPEEAILSAFRMFDPSGQGVVNKEEFKQ 129

  Fly   128 LLTTMGDRFTDEDVDEMYREAPIK-NGLFDYLEFTRILKHGAKDKDE 173
            ||.|..|:|:..:|::::...|:. .|..||.....|:.|| .:|:|
  Rat   130 LLMTQADKFSPAEVEQLFALTPMDLTGNIDYKSLCYIITHG-DEKEE 175

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
sqhNP_001284928.1 FRQ1 15..170 CDD:227455 75/156 (48%)
Myl7XP_006251278.1 FRQ1 22..169 CDD:227455 69/146 (47%)
EFh 36..132 CDD:298682 49/95 (52%)
EFh 110..168 CDD:298682 17/57 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0031
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1435392at2759
OrthoFinder 1 1.000 - - FOG0000218
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR23049
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X162
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
76.920

Return to query results.
Submit another query.